CAZyme Information: MGYG000003679_01880

Basic Information

• Species: Treponema_D sp002449305
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002449305
• CAZyme ID: MGYG000003679_01880
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	MGYG000003679_161|CGC1	28872.56	5.1611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003679	2427938	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 15820; End: 16587 Strand: -

Full Sequence      

MDYEHNYFIKLVSGTVAFSLFFVALCVFTLIFIPAEKSAENIVASENAQSEPLQEQSVNY
ESIFDKEYPELVIETKNKDDAGLILYKQPQSRAAVEWYYSRVVNSREVAQAVLQSAEEFN
IPLSLAFALAHTESNFKVTAMHKNTNGSIDRGLFQLNNTSFPKLEESDFYDPKTSAHYGL
SHLRFCLNTAGNEIAALAMYNAGANKVRKNSTPQITLDYISKIQNYKRDLEDNFAVEVLA
LYNTETQKNLLAKKF

Enzyme Prediction     

No EC number prediction in MGYG000003679_01880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	124	239	6.3e-17	0.7481481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	3.64e-18	119	228	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.12e-13	116	209	5	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	1.97e-12	110	220	6	128	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK15328	PRK15328	4.22e-10	113	228	23	141	type III secretion system invasion protein IagB.
cd00254	LT-like	7.93e-10	124	226	2	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB15087.1	4.22e-168	1	255	1	255
QQA00741.1	9.78e-117	1	253	1	253
QOS41265.1	2.74e-83	12	250	12	247
AEE17629.1	6.08e-75	13	252	16	263
QSI03055.1	1.06e-71	78	254	48	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07568	1.03e-08	114	209	23	124	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	2.67e-08	114	209	23	124	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34