CAZyme Information: MGYG000003680_00659

Basic Information

• Species: Prevotella sp000433175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000433175
• CAZyme ID: MGYG000003680_00659
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	MGYG000003680_54|CGC1	79600.83	4.7382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003680	2339843	MAG	Italy	Europe

• Gene Location: Start: 7596; End: 9683 Strand: +

Full Sequence      

MATTSKATWIWYPGDYEIWLGNKMNNRRTDRGAYFPPFWKQDSHYVTVEFSKAVELTEEE
TLTIATEGDYNIKIDGKMLFGMPKQFTLSAGSHRINIKVHNQATPPALYISGKTVFTDAT
WNVTFEDKEWIDESGKASDTSSTVYMSAGCWNFDKQNELPSGFKLSRKHFDAVGNDSGLY
DFGRETFGYAILNGIKGNGTIDLYYGESEEEARDKEHCETLDKLVVEDGKITDLATGKTE
ELSAAYTMGNSKAFRFIYVETAGCTVESISMDYEYMPEEEKGSFKCNDEELNRIWEIGAY
TMQLTSREFFIDGIKRDRWVWSGDASQSYLMNFYLFNDNDMVKRTTWLLAGKAPVTSHIN
TIMDYTFYWFISIYDYYLYSGDSHFLTQIYPTMQTYMDYVLGRTDNDGMVEGMTGDWVFV
DWADKPMDKQGQLAFEQILFRKSLESIATVARIVNDAESAVKYQKLADAIGEKLLPYFWN
DSAKALMHNRKDGKQSQDIFRYPNMFAIMYGYLDKEKQETVKNSVILNDDVIKITTPYMR
FYELEALCMLGEQDQVMKEMKAYWGGMLKEGATSFWEKYNPDEHGREKLAMYGRPYGKSL
CHAWGASPIYLLGRYYLGVQPTKPGYEEYTVRPCLGGLDWMEGNVPTPFGTVYVKMDKNT
VTVKSDGGKGTLIAGIGEDEKHIEIKTGKEITINL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	176	662	5.6e-110	0.9563492063492064

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.06e-28	279	615	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.52e-06	360	480	81	212	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17390	Bac_rhamnosid_C	2.07e-05	618	655	1	39	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.89e-04	360	481	336	464	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG4354	COG4354	0.001	373	456	451	531	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT58576.1	0.0	2	690	16	709
ABR40300.1	0.0	2	690	16	709
QQY37560.1	0.0	2	690	16	709
QEW37285.1	0.0	2	690	16	709
QUT83668.1	0.0	2	690	16	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	0.0	2	672	13	692	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.35e-46	245	650	496	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.59e-31	287	615	212	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	6.18e-13	254	659	700	1115	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P9WF03	2.76e-09	164	667	354	861	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003680_00659.