CAZyme Information: MGYG000003680_01075

Basic Information

• Species: Prevotella sp000433175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000433175
• CAZyme ID: MGYG000003680_01075
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000003680_110|CGC1	36471.43	8.2654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003680	2339843	MAG	Italy	Europe

• Gene Location: Start: 5923; End: 6906 Strand: -

Full Sequence      

MKKIFITILVAVCAIAASKAANPYDNPDTLVVSRDGTGQFRTIGEAVEVCRAFMEYHKVI
YVKNGVYKEKIVIPSWLTNIEICGESVENTIITYDDHANIRLVGTNQPMGTFRTYTVKVE
GTDITFKNITIENNAARLGQAVALHTEGDRLVFVNCRLLGNQDTIYTGTPGTRVYFKDCY
IEGTTDFIFGPSTAWFENCTIHSKQDSYVTAASTPNDVVYGYVFNNCRLTAAEGVTKVYL
GRPWRPYAYTLFMNCELGAHIVPAGWHNWGKTSNEQTARYLEYNNKGAGANTAKRAAWSK
QLTKKEAAQVTLENVFKTSSNWIPAVK

Enzyme Prediction     

No EC number prediction in MGYG000003680_01075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	317	9.6e-103	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	3.54e-80	30	309	7	289	pectinesterase
pfam01095	Pectinesterase	4.58e-78	31	311	3	290	Pectinesterase.
PLN02682	PLN02682	1.72e-65	19	324	60	368	pectinesterase family protein
PLN02432	PLN02432	5.75e-64	30	308	13	278	putative pectinesterase
COG4677	PemB	7.25e-64	27	317	80	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	9.29e-175	1	324	1	322
ADE82952.1	9.29e-175	1	324	1	322
BCS84477.1	1.20e-173	1	326	1	325
QJR97878.1	1.99e-168	17	324	9	318
AGB28242.1	7.52e-165	1	325	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.10e-43	30	325	9	310	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.58e-42	31	298	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.16e-40	30	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.29e-40	30	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.07e-31	33	326	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	4.24e-58	29	323	272	573	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9LVQ0	2.40e-57	32	307	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q42608	7.06e-56	29	323	259	560	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV6	1.41e-52	29	323	276	571	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
O80722	3.86e-51	31	323	278	571	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999146	0.000175	0.000140	0.000136	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003680_01075.