CAZyme Information: MGYG000003681_02511

Basic Information

• Species: Bacteroides stercoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercoris
• CAZyme ID: MGYG000003681_02511
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000003681_21|CGC1	34653.55	9.866

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003681	3833391	Isolate	China	Asia

• Gene Location: Start: 36653; End: 37534 Strand: -

Full Sequence      

MKELRLFLRKIDQKVISKGKHYLLTLIILYRYKTNEVLDHYKEQTPQKEEPIGATSPIWV
CWWQGEKKMPDIVKACYSSICRHADNHPVILITEKNFQEYATMPDFIMQRLYKREMTITH
FSDLLRMNLLKRHGGIWLDSTILLTKDIDSIINTSLPYYSHHHIPNNCNVVKGKWTGFFL
ACGKGNILPSFILDAFYNYWKNNNRIVTYLFIDYLFALAYKHIPAVSKMVNNIPVQPMSN
LSKCLNQEYDKKAMETFYTKYHFHKLTYKKAFAMQTRNGKKTIYAHLLTDKAF

Enzyme Prediction     

No EC number prediction in MGYG000003681_02511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	154	8.1e-19	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05704	Caps_synth	2.73e-67	9	287	1	278	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	1.24e-04	70	152	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68060.1	1.21e-119	7	288	14	294
AQR95087.1	1.55e-58	33	290	61	320
AKP76105.1	6.84e-54	57	291	71	308
CBL39560.1	1.57e-47	12	290	48	329
CAD0180094.1	3.00e-47	21	291	54	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999901	0.000115	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003681_02511.