CAZyme Information: MGYG000003682_03098

Basic Information

• Species: Ruthenibacterium lactatiformans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruthenibacterium; Ruthenibacterium lactatiformans
• CAZyme ID: MGYG000003682_03098
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000003682_27|CGC1	74968.62	4.3512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003682	3961825	Isolate	China	Asia

• Gene Location: Start: 24957; End: 26984 Strand: -

Full Sequence      

MKLKICRFLSAALVMVMLTGLGTAFAVFSEWSVRVEAEDGVMTGTVRTENVIGDSGRTVS
FIDNGPANSLELQVTPQGGTDYIMKLRYRSGEVRDLLYQINGGPTSRISGFNSGSWNTFA
NMSVPVALNPGQVNTVRFFAPDGENGPGLDYVGFSASDVPPVDKPGYRLIFQDEFEGETL
DDSRWVPQYLSSWAQKPELAEPTYIMENGLMRLQIFAETQPWCPEYDGETVVSGFTTGDR
NALHNWNGTNTVRNPVEMQATHLNQYGYYEIRAKGQSGSARHAAWWLLGFEDVPDESAEI
DIFEILGNNSHKVPVNFHAWNDPDAPDGGGFSYTNRQMDFHEEFHIYGFNWIEGGGQGEA
PDKMEFYVDGVKTGERNVNIDYPVLQLFSLYEKRAGGWTGIWLPKPYPNTFDIDYVRVYK
PVPGGQALPKEQLAIAGVEAQEVMVLPSARPAQYVSAVAGHEGEIFTEAHLPGVRSYVNV
LYNDGVKTQEFVRWPALSEEQYSRLRHGETVMLEGITPNLSADAPGYQAPVLTLRPAPWD
TNLNPKGIENLFDGDTSSTPSCWTETMEPMPQGGYISFRFEETKTVNGIRFSANYGNGQG
IRSCTLSFWDTQTGAWADEGVEYTIPWTSAGDNEAGETVLVPLAEPVVAQAVRINITSVN
THWENKIVMREIEFV

Enzyme Prediction     

No EC number prediction in MGYG000003682_03098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	172	419	2.2e-71	0.995850622406639

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	3.35e-31	173	419	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	3.46e-23	173	420	27	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd08023	GH16_laminarinase_like	3.20e-21	171	419	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd04081	CBM35_galactosidase-like	1.17e-16	36	152	4	123	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
pfam00722	Glyco_hydro_16	8.71e-10	265	417	32	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCJ40812.1	3.99e-179	161	674	117	647
AIF44579.1	1.21e-171	161	674	114	641
AWS25493.1	7.34e-108	34	515	37	586
ASY50995.1	7.34e-108	34	515	37	586
QUT50278.1	2.21e-83	156	515	25	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UPS_A	7.32e-43	149	424	10	282	GlcNAc[alpha]1-4Galreleasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens],1UPS_B GlcNAc[alpha]1-4Gal releasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens]
2VY0_A	5.50e-09	158	424	4	264	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
3WZ1_A	6.85e-06	222	423	62	276	Catalyticdomain of beta-agarase from Microbulbifer thermotolerans JAMB-A94 [Microbulbifer thermotolerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	2.29e-09	44	420	281	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q9ZG90	6.54e-06	167	420	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006508	0.992145	0.000527	0.000278	0.000237	0.000260

TMHMM  Annotations     

start	end
5	27