CAZyme Information: MGYG000003682_03102

Basic Information

• Species: Ruthenibacterium lactatiformans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruthenibacterium; Ruthenibacterium lactatiformans
• CAZyme ID: MGYG000003682_03102
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase XylQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MGYG000003682_27|CGC1	57684.65	5.6248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003682	3961825	Isolate	China	Asia

• Gene Location: Start: 30338; End: 31873 Strand: -

Full Sequence      

MEIKILKEEYWYGGCAAWGGQMPLGERSEADLQLEPNPTPNQAMPLLVSSRGRYLWLDGV
EEVKFSGGYIHCQGTAELYPNGEQSLQAAAEKQTLRDAYQKAMERHFPFSGKIPAKELFE
APVFNTWIELTFDQNQQAVLRYARNILDSGFRPGVLMIDDGWAECYGDWQFHKGRFPDPA
GMLRDLHGLGFKVMLWVCPYVTPDSKAYREAVQKGFLLQNESGGSFVAEWWNGFSAAVDL
STHPARSWLDTQLEALRGLGVDGFKFDGGDPTHYVGAYSGGKAVIPNEMSHFWAEFGLRY
PLNEYRSAWKAGGLPLMQRLCDKDHSWGKTGLAALIPDLLAQGITGHPFGCADLVGGGEY
LNFQKNAGWLDRELFLKHAAVSCLTPVIQFSAAPWRILNADQLRTVHAQLAVRRQWQEYL
EQVLCECARTGAPAVRYMEYEFPHQGMEQLLDQYMLGSRLLVAPVPEKGKTAREVYIPRG
EWLWEGKLLHSRGEVLEFYAPDTFLIVLERQ

Enzyme Prediction     

No EC number prediction in MGYG000003682_03102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	123	501	1.2e-65	0.8969555035128806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	8.92e-142	120	482	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	3.46e-47	160	510	304	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	4.16e-40	155	497	61	425	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	2.07e-31	168	501	260	609	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	3.57e-28	124	390	11	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO30874.1	9.66e-204	1	510	1	500
BCJ98257.1	9.03e-182	1	510	1	501
QIB55881.1	9.66e-179	1	510	1	500
QMW76252.1	9.66e-179	1	510	1	500
QBE95882.1	5.53e-178	1	510	1	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	1.75e-27	168	495	290	635	ChainA, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5F7U_A	2.69e-26	160	510	421	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5F7S_A	3.64e-24	174	511	365	728	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0D_A	2.00e-23	160	510	421	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	2.02e-23	160	510	442	818	1.9Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZQ1	4.98e-58	103	502	296	705	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
Q6NSJ0	6.70e-58	103	502	297	703	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
P96793	4.72e-27	44	511	195	670	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
P31434	2.08e-22	103	508	251	671	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q9F234	2.82e-22	134	491	272	651	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003682_03102.