CAZyme Information: MGYG000003683_00260

Basic Information

• Species: Bifidobacterium pseudocatenulatum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium pseudocatenulatum
• CAZyme ID: MGYG000003683_00260
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	MGYG000003683_1|CGC6	58053.02	10.8968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003683	2206268	Isolate	China	Asia

• Gene Location: Start: 327889; End: 329592 Strand: +

Full Sequence      

MSGTQAHHAGGTRARIGRAATGVVSSAAQFGADRTDIADSMGHTAAEMAGRAGIYGMSST
MHGVGWTAGRARRVMNRGKRALRSGNGMRKAVGKPKVLSEAKPSEKIGKFTAKGKASRRI
GKRIGAGLGKAGRGVKRMGSTGMGWMDKTGARLTAADDDFASKLGSATRDLSFKAARTGV
RGVNSSAKFIWRRRRAPVKAVRSVKATGQAAMRAARAAANFARTSVSRAIAGAASISLPI
MPVIAAMLAVLGVLLAAMGAFLGSSASESTVSGVPAEYEADVIRAGSICQVVTPGVIAAQ
IDQESGWNPKAGSSAGAQGIAQFMPSTWASAGKDGDGDGKADIWNPHDAIWSQGNYMCGL
ASQVETAKKSGKLTGDTLELTLAAYNAGLGSVLRYGMVPPFEETINYVRRIKELAATKYT
ATGTAEGGTVGSLEPKLTVSGGIVSTAGITPDTRYPWGQCTWWAATRRADIGKPIPGWGN
AATWAGSAASAGYTVDGSPSAGSVIVFQPGVLGASAGYGHVAMVEEVRGDGSILISESNV
LGLGVVSTREISASQLAAAGSGVRYIH

Enzyme Prediction     

No EC number prediction in MGYG000003683_00260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	291	420	8e-28	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	4.01e-37	292	417	3	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK08581	PRK08581	1.01e-34	455	566	508	616	amidase domain-containing protein.
COG3942	COG3942	5.77e-33	415	567	27	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.83e-25	294	411	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam05257	CHAP	6.77e-22	451	539	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR03831.1	0.0	1	567	1	567
QGM62967.1	0.0	1	567	1	567
AYZ89076.1	0.0	1	567	1	567
AHJ15822.1	0.0	1	567	1	567
VEG21876.1	0.0	1	567	1	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	5.48e-18	455	554	248	348	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
2K3A_A	2.29e-16	445	567	43	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	9.84e-14	455	567	11	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
4CGK_A	5.40e-09	450	542	282	365	Crystalstructure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39],4CGK_B Crystal structure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39]
1LTM_A	6.56e-06	296	357	159	219	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	6.73e-17	427	557	135	259	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q2G222	1.10e-16	455	554	508	608	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q6GJK9	1.05e-15	436	567	198	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
O31976	2.50e-15	292	411	1435	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.50e-15	292	411	1435	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988274	0.011460	0.000216	0.000035	0.000015	0.000033

TMHMM  Annotations     

start	end
229	251