CAZyme Information: MGYG000003683_01746

Basic Information

• Species: Bifidobacterium pseudocatenulatum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium pseudocatenulatum
• CAZyme ID: MGYG000003683_01746
• CAZy Family: GH13
• CAZyme Description: Pullulanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	MGYG000003683_3|CGC8	75402.53	4.6841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003683	2206268	Isolate	China	Asia

• Gene Location: Start: 306633; End: 308696 Strand: +

Full Sequence      

MTLVNSLENNFEQPNTRVAEPFPLCLERPLGAVVSQSGTQFAIWAPTAEKITLRLFSRGS
RGEDGDALIGQFLMRPEADGSWTYDFADNKHGLYYDFLIERDCGSVDRVADPWAHAAGVN
GRRSMVVDLRRTDPEGWDADRMPEVPIAQTVVWETHVGDFSNDPAGGFPESHRGKYLAFT
DLGTTLDGHPDFPTGLSYLKKLGITAVQLMPIYDFGSVDETTCSRYNWGYDPVNYNVPEG
SYSTNPYDGSVRIREVKQMVQALHNAGIKVIMDVVYNHMFSPDNWFERIVPEYFLRRKPN
GALSNGSGCGCDMATERAMFRRFVVESVAYWAREYHLDGFRFDLMGLIDVDTMNAVRAAL
DEIPDRGPSILMYGEPWSASATAALPGTVLADKAGLPQLDNRIGHFCDTTRDAIKGHVFF
SDRPGYVNGGMHENAASVRDAVNAWRASKQPEGVAGQVIQYVSAHDDLTLWDKLCASFAA
KSLGSAVSEGDNENSVDVPKALYDADLSEAGLASAGSAIAGAMATVMDANRMAAGIVLTS
AGIPFMLSGEEFARTKYGNSDSYDSARELNWLDWTRAWRMRDLVEYYTKLIALRKSSAEW
FDGDRVIVSVEGDELVFRVGDYLVAVNPGRHIGAIDVASTAVAPVSESSRVWCGMGSSTN
ASAACISAGDGDYLIVPPHTFAIWRLR

Enzyme Prediction     

No EC number prediction in MGYG000003683_01746.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	196	551	7.3e-105	0.9965397923875432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	0.0	27	596	9	528	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	0.0	151	594	4	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	3.54e-120	12	628	51	618	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02103	pullul_strch	7.36e-96	30	575	128	729	alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PLN02877	PLN02877	1.34e-82	27	575	212	798	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR04399.1	0.0	1	687	1	687
AXR42386.1	0.0	1	687	1	684
QHB63490.1	0.0	1	687	1	684
AII76859.1	0.0	1	687	1	684
AJE06696.1	0.0	1	687	1	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LSA_A	3.28e-142	30	596	64	613	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	5.08e-141	30	596	64	613	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	5.36e-141	30	596	64	613	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	5.51e-141	30	596	64	613	ChainA, Pullulanase [Ruminococcus bromii]
6JEQ_A	5.73e-129	30	596	41	560	Crystalstructure of Pullulanase from Paenibacillus barengoltzii complex with beta-cyclodextrin [Paenibacillus barengoltzii],6JFJ_A Crystal structure of Pullulanase from Paenibacillus barengoltzii complex with maltohexaose and alpha-cyclodextrin [Paenibacillus barengoltzii],6JFX_A Crystal structure of Pullulanase from Paenibacillus barengoltzii complex with maltopentaose [Paenibacillus barengoltzii],6JHF_A Crystal structure of apo Pullulanase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],6JHG_A Crystal structure of apo Pullulanase from Paenibacillus barengoltzii in space group P212121 [Paenibacillus barengoltzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0SPA0	1.40e-100	30	596	106	615	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
O33840	2.32e-99	30	595	225	746	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
Q8GTR4	1.47e-56	29	575	207	791	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
P07811	6.83e-55	31	575	315	921	Pullulanase OS=Klebsiella aerogenes OX=548 GN=pulA PE=1 SV=1
P07206	1.33e-53	31	575	305	911	Pullulanase OS=Klebsiella pneumoniae OX=573 GN=pulA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003683_01746.