CAZyme Information: MGYG000003684_00372

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_00372
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818	MGYG000003684_1|CGC17	94728.19	6.0769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 461701; End: 464157 Strand: +

Full Sequence      

MGQSDKKQEDFWFTLLRREDERALWHPELELLFVLKGAGRVCLAQNGPVYRINEGDIFAV
NSFQMLELELDGDACALSLSISLHYLASVSPELLNHRVNCRSFLYPKDRQGSYDVLRNNL
ARAFQAQYKYEMRQSLYIKNRIAALLENLVRHFLEEKEELPEGSGWERLEQAIDYIHNNY
REPITLEDLAEHTFLSRTYISHSFRRYLGVSFMEYLTRVRVCHAVWMMHGRETLTEIAYN
SGFPNVNAMIKAFKQYRGMTPGEYRKQAAAQQETPQTAAAEPDEMNHVFSSLMRYAGSDP
EVKQYKEKVRELVIDLEGRKPRITQHWKRIMNAGYARELLDGARQQEIMLLQQQIGFEYI
RIKGILDDDMCLLRTDMIGNRVKNFTYVDEAIDFIVSAGAKPMVELSNMPRLLARSTSIP
SMRAGVVSYPESLEAWKDLIRSLLEHLVERHGRDRVRQWLFAPWLIPEYMNFGVCTEAEY
EEIYTCTYETIKSVCGNFLVCGPGTTDCRKYLPQFLAMCRRRGCMPDIISFRSFAGVNPE
EEEGGLNLIVGNESFPMAVSRDEDILFHLTEEARGILKQAGAGALPLVVEEWSSTIWQRD
LCNDTCYKSAYLFKNVLENNAHLSGMGYFALNDRLDEIPPVPQMFCGGFGLFTKNSVKKS
AYRAMELLAQMGDRLVEKGNGYFISQRDEEIQIFLYNYCHYDLLYRYRHTVNMTQTNRYQ
VFQPKEAEAFFIQMSHLAPGKYRIKRYGITRQGGSSYDAWVRMGAPDTLNQEESAFLEAG
SYPEYRTECEEVREEEPVLNIRASVKPLEVMLIKIRKE

Enzyme Prediction     

No EC number prediction in MGYG000003684_00372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	323	769	4.6e-85	0.9860788863109049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	9.03e-45	322	787	13	461	Glycosyl hydrolases family 39.
COG2207	AraC	3.07e-29	164	268	17	122	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	5.86e-26	183	265	1	84	helix_turn_helix, arabinose operon control protein.
COG3664	XynB	1.41e-22	345	816	7	425	Beta-xylosidase [Carbohydrate transport and metabolism].
COG4753	YesN	3.66e-22	138	267	345	473	Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ24049.1	1.07e-231	10	817	10	819
AIQ21948.1	9.68e-136	11	817	16	843
AYA77562.1	1.83e-132	25	815	30	828
AWB46610.1	1.38e-130	25	783	31	811
AIQ37108.1	2.85e-129	25	815	30	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFG_A	2.10e-46	322	817	13	482	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
2BS9_A	3.88e-46	322	817	13	482	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	5.28e-46	322	817	13	482	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
4M29_A	9.98e-41	313	779	10	462	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.35e-40	313	779	10	462	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	5.39e-43	322	817	13	483	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	1.68e-38	306	677	3	362	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
P36906	3.72e-38	322	787	13	453	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	5.02e-38	309	787	2	453	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
Q6GKK1	5.36e-23	15	783	6	710	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_00372.