CAZyme Information: MGYG000003684_00551

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_00551
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	MGYG000003684_2|CGC1	91728.7	4.8026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 35728; End: 38199 Strand: -

Full Sequence      

MIKIPFSLGWERAIGQSKEFWLGNDNPRVKVDLPDDFIINQPRTAEAVGGASTGYFPGGR
AVYTKCFEAPAEWSDKTVVLDIDGAYMNAEVTMNGEALGVHPYGYTPWQLDLKDAIIPGE
KNELEVVTRCIQPNSRWYSGGGLYREVSLWIGEACHIRPWDIAVTTAKVRDSHAVIHIEA
VVTNESEKDAQGTLQIRVGETKASLPVKVAAGSTRKMESDIEVVGPVLWSAESPHLYHLE
LELQTNLGTDHSELPVGIRKIEIDAKNGMRVNGQPVKLLGGCIHHDNTLLGAAAFPRAEE
RKIELLKTAGYNAVRCSHNPPSEALLNACDRLGMYVIDETFDCWRVGKNDQDYHLYFDEW
WQRDTEAMVRRDRNHPSVFCWSVGNELVEAGGMSKGVELAGMQADFVRSLDPDRPVMAAF
HSMIKTKREKDKPPRMPFAAASQKNDSEKGGSEEVMKRMADPAVFEKMIENIATNNMGDG
FVNGEDVWGEISEDCAAMLDIVGYNYLPKRYTADAKKYPDRIICASETHANNTYDYYQAM
MENSNVIGDFIWTAYDNLGEAGAGRVLRSVQDMASGMLGAWPWLSCYQGDFDLDGNRRPQ
SYYRKVMWQKDDGIHLFAKPPQYTGRKSQGLGWQWSDVWKSWTWPEAYIGKDIDVECYAD
CDTVEFILNDEVVGTAPVTRFKAEFTLPYQPGTLKVIAHKEGRITAEDTLITAGEPKGIR
LIPDRKEIRADGMDLCFVKVCLVDGEGEIVPTDDLEVTADVEGGNLAGFGSGNPCTDENY
GTGKRKLWKGQGLICLRAPMEPGKITLKVTGKGFEEELEIRCS

Enzyme Prediction     

No EC number prediction in MGYG000003684_00551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	25	603	2.3e-101	0.574468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.35e-68	62	417	66	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.17e-40	59	432	65	459	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.19e-35	62	416	112	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	6.90e-34	63	416	124	485	beta-galactosidase.
pfam18565	Glyco_hydro2_C5	1.24e-30	719	816	1	99	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ23210.1	1.30e-191	10	814	9	774
QGG57161.1	2.20e-190	31	814	22	769
QUL57111.1	3.62e-186	24	815	25	804
AJG98217.1	6.18e-184	1	816	1	805
QNP51570.1	2.55e-183	6	814	28	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.56e-158	24	814	30	768	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.70e-158	24	814	30	768	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	4.16e-123	4	815	28	812	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.99e-112	24	817	35	801	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	3.54e-109	24	814	29	792	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.17e-124	6	816	47	841	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.20e-65	2	811	47	811	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	2.46e-35	63	820	60	734	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	2.12e-31	39	728	82	718	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	6.73e-30	62	386	113	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_00551.