CAZyme Information: MGYG000003684_00621

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_00621
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000003684_2|CGC5	97813.78	4.9283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 123095; End: 125668 Strand: -

Full Sequence      

MSTIKTDTYNTFTYKKDRQRAISFPVGGLGSGSIGIAGNGCLIDWQVYNRPAMGTRNGYS
HFAVKAQAGDELLDARVLVSDLGKPYLGQVDERTMLGMPHFRELVFEGKYPMAELSFLDE
RFPGRVTVRYYNPFIPLNDRDSSIPALFADILVENTTDRPITYTTAGIITNPCQSSFTRN
RFREGNGIRGIHFTTEEIDKGDVSYSDFTLAADSEAACQEYWFRGNWRDHVETYWREFAS
AKPLENRRYENGKKDYKDTGMLCISKETAPGEMQEFHYVLTWNVPNCNNYWSGLDISTSN
IHYDVCDRTPWKNYYAVLFEDSWASASYALHNRQRLLGETLTFMDAMYETTIPEAALDAV
TANLAILRSPTCLRLEDGSFYGWEGCFDNVGSCEGTCTHVWNYAYALPFLFPALARSIRD
LEFRYSQRADGGIEFRLRLPVGSTGKWFHSCADGQLGSIMLTYRDYKISGDREWLASKWE
SVKKALAYAWSEENPDAWDRGKKGYLDGRQHHTLDMELFGPNAWLQGFYAGALSAAAEMA
AVLADREAEEEYRELAAKAKEYLNRELFNGEYFYQKVDVCDRSVVERFQAQDDYWNEEKG
QIKYQIADGCGIDQVLAQWHGNLCGLPEIFEQDKARCALDAIFHYNYKPSLGEIYNPWRI
FAIDEEGGVIMCEWPEGTLKPAIPLTYAQECMDGMQYQTASHMIWEGMLEQGETIVKAVR
EKYRGDNRNPWCEIECGSYYARSMASYALLLSYSGFTCDLDQGILGFRPRRRCADDSFTS
FWSAGSGWGRVRYQSDGSIILEIIRGSLFLKQFVTGTEGNIAKVSCDGKEQKFTREKDRI
SFTEKVRIEKSLELKAD

Enzyme Prediction     

No EC number prediction in MGYG000003684_00621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	381	749	4.8e-59	0.9889807162534435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4354	COG4354	3.55e-36	103	756	89	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam12215	Glyco_hydr_116N	1.06e-33	37	336	15	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	1.38e-33	393	749	6	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98507.1	1.09e-301	10	854	2	862
ANE45793.1	5.52e-297	14	810	5	816
QHT59778.1	1.45e-293	14	854	5	859
QGQ98288.1	6.65e-292	14	810	5	820
BBH18759.1	7.41e-292	14	842	5	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DKW_A	4.20e-16	25	754	59	789	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKW_B Chain B, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKX_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKY_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7DKS_A	2.18e-15	25	754	59	789	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7W2V_A	2.98e-15	25	754	102	832	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	3.74e-15	25	754	55	785	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	3.77e-15	25	754	58	788	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000020	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43