CAZyme Information: MGYG000003684_01270

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_01270
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	MGYG000003684_3|CGC5	28256.44	6.2679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 300709; End: 301458 Strand: -

Full Sequence      

MKFIKKLILSLFFLLLLAACAVGGHFVWQGYQIYQQVIQETPLADKVEEIRSKPHYTTIS
QLPDIYKNAVVAVEDKRFYRHGGIDLLSTGRAVVTNIREKKLAEGGSSITQQLAKNLYFS
QEKKFLRKVAELFVAFDLEKNYSKDEILELYLNTIYFGSGYYCVYDAAEGYFGKEPGQMN
DFESTLLAGIPNAPSVYALTNKPELAAQRQRTVLECMVDQKYLTSDDAKEILKWGEQAKQ
AMAGETEIQ

Enzyme Prediction     

No EC number prediction in MGYG000003684_01270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	218	8.6e-60	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	5.47e-77	41	218	3	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.12e-71	56	233	4	181	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.78e-66	55	233	77	256	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.58e-63	56	234	69	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	2.28e-51	45	232	36	229	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	1.96e-85	1	233	1	233
QNM09777.1	4.46e-84	26	232	35	241
QJU22158.1	1.43e-83	29	235	28	234
QRP41835.1	1.17e-82	29	235	28	234
ASN93505.1	1.17e-82	29	235	28	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	8.15e-44	53	230	19	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	3.25e-43	53	230	19	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	2.87e-40	44	223	47	232	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.94e-40	44	223	11	196	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	3.02e-40	44	223	12	197	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	1.92e-42	5	228	7	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q07259	6.04e-42	3	219	8	211	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q4L7I0	1.22e-41	44	232	70	264	Monofunctional glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=mgt PE=3 SV=1
O87579	5.67e-40	56	224	70	238	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	1.06e-39	56	224	70	238	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.302582	0.019029	0.674852	0.000149	0.000094	0.003297

TMHMM  Annotations     

start	end
7	29