CAZyme Information: MGYG000003684_01331

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_01331
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000003684_3|CGC9	86718.91	6.452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 374295; End: 376652 Strand: -

Full Sequence      

MKKESFNKDWLFVSKKSEIKKRVTLPHDAMQGEERRADCESGSAGAYYPGGVYEYEKHFT
APEQWAQQHIVFEFEGVYKNARVYINGKEAGGAAYGYIPFFVCADGLLGYGEDNVIKVTA
DNSRLPDSRWYTGAGIYRPIWLHTGGKTYIEPEGIRIKTLDYRPARIQAEVLASGGEAEI
EILDQGKVIAAASGKRAEMTLPDAVLWSEDTPYLYTCRVTLKENGKTVDTAETAFGVRKI
EWGSRGLFINGKETLLRGGCLHHDNGILGAAAYKESEWRRVRLLKEAGYNAIRSSHNPAS
RAMLEACDALGVYMLDETWDMWYSKKSRYDYAEDFEANYKYDLRAMVERDYNHPCVIMYS
IGNEVSEPAFEKGRKLAGEMVDYVHTLDDSRPVTGGINLMIIAKSSKGKGIYKEDGSGAD
TAGNEKKMQGMSSTMFNMITSMVGSSMNKAANSKTADAVTSPVLDTLDIAGYNYASGRYP
LEGAAHPERVIFGSETFPQDIYKNWEMVRKYPYLIGDFMWTAWDYLGEAGIGAWAYTPDG
KGFNKPYPWLLADVGTFDILGNPNGELFWAQAVWGCLKNPAIAVQPVNHDRKPAKGAWRG
TNAIPCWSFQGCEGRKAVVEVYTQGAAAELFLNGKSLGKKKTKECRAVFQTKYAPGRLEA
AAYDRDGKETGRSVLQSADGRIGISLMAEKNPVKAGELVYVDVALTDQNGNLEGNADCRL
KAEVRGAELMAFGSANPRTEERFDSGSYSTYYGKALLAVRAAEKGSIYVKVSGEAGTAEI
TIKAE

Enzyme Prediction     

No EC number prediction in MGYG000003684_01331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	573	6.5e-105	0.6077127659574468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.39e-63	49	394	81	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.36e-46	48	394	63	446	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.62e-32	55	364	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.26e-27	55	422	124	495	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	4.57e-18	246	394	6	159	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97750.1	0.0	1	774	1	773
AFN84582.1	1.87e-309	1	785	1	770
AHF23998.1	5.29e-258	1	783	23	826
QTL78998.1	1.02e-242	23	783	29	800
CBK92219.1	2.36e-231	1	774	1	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.06e-121	1	782	5	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.60e-121	1	782	5	775	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	1.12e-91	1	774	1	790	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	2.49e-89	5	785	29	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.01e-87	21	773	40	797	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.06e-82	23	785	74	837	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	7.02e-66	5	761	50	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	3.65e-34	3	641	53	676	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.24e-28	55	400	60	418	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q56307	1.04e-26	49	372	110	450	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_01331.