CAZyme Information: MGYG000003684_01411

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_01411
• CAZy Family: GH8
• CAZyme Description: Endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000003684_4|CGC1	45681.4	4.8258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 29255; End: 30451 Strand: +

Full Sequence      

MTGRRENYPFPHRGGYKQGFLPNRSREKMNRDLQHLYESWKALYLTTEGCLEGELRVSGG
NCYQFGTCSEGTGYGMLLSVYMANAQNHAHEEFDSIFRYYKNHSLPECGLMRWEADRTGK
DLSEYVAPDGDLDVAFALLAAHRQWGSEGEICYLEEGKALVGNLMAYTIIKPQYLIARAQ
LENPEGLSWDYTMSSYQIPAYARLFAEITGDAGWKEVRDAAYRLFAYFYKLNPDTALAPF
VFHLDTFGPGGGKPYVFSYDSCRVPWRTALDYLWYGTDETGLAHDYPHRNAVWFSRYMES
LNWDFDRVSERFLLSGMPVSEKCSPRNITAMLAPAAMVDESTRELLDRSYDYLSRQEPML
EWPGDYFQDTLVLLGMLTITGNMPNFYTTEPYPADKAL

Enzyme Prediction     

No EC number prediction in MGYG000003684_01411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	36	378	1.6e-57	0.9875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.10e-25	37	381	8	321	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.86e-15	36	276	28	259	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.90e-05	67	276	52	254	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFK65327.1	4.38e-114	6	393	55	442
AFH61167.1	4.38e-114	6	393	55	442
AEI40301.1	8.70e-114	6	393	55	442
ASN18667.1	1.90e-112	6	396	52	442
AFC28935.1	1.06e-111	6	393	55	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEM_A	3.71e-38	37	385	31	358	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	1.00e-36	37	385	31	358	ChainA, Endoglucanase A [Acetivibrio thermocellus]
5XD0_A	5.89e-34	7	382	34	405	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
7CJU_A	8.38e-32	1	382	4	386	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1V5C_A	1.36e-31	5	382	2	380	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37701	1.74e-42	1	393	29	399	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P37699	6.38e-40	6	393	34	399	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2
A3DC29	1.40e-35	37	385	63	390	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P19254	3.22e-33	7	382	34	405	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.58e-30	5	398	58	447	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_01411.