CAZyme Information: MGYG000003684_01706

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_01706
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003684_5|CGC1	42855.66	4.4152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 10778; End: 11887 Strand: -

Full Sequence      

MLQEVDRKLQQLIGAFSEILYEDDEIFMENMRRKKNLPEEELQKYAHWEWTQGVGLYGIW
KLFAASGEKKYLEMLTRYYDRQLQVGFPQCNVNTAAPYLTLSYLAEYLQSETYLQPCREA
AEWIMYEMPRTSEGGIQHMTSDDVNEQELWDDTLVMTVLFLANMGRILDREDYRNEAQYQ
FLLHMKYLQDPVSGFWYHGWTFLERNHFAGAFWGRGNCWITIAIPELLDSIACSEPVARI
LQETLRNQVEALAGYQSDSGMWHTLLDDPESYEEASATCGFAYGILRGVHCGLLEEKWLG
TAERALKPVLSLISEEGVLGQVSYGTPMGRENRDFYKEIPLKPMPYGQALAILFLVEWKK
LRADDEVTE

Enzyme Prediction     

No EC number prediction in MGYG000003684_01706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	359	6.2e-99	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.63e-106	23	357	12	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.12e-98	29	361	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH70918.1	2.27e-160	3	357	4	357
QQR00386.1	1.45e-159	4	360	7	362
ANU44854.1	1.45e-159	4	360	7	362
SET92327.1	6.30e-159	2	360	1	358
BCJ96760.1	1.67e-153	4	357	8	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	5.84e-96	45	358	63	377	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	5.14e-94	45	358	62	376	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.18e-87	4	360	7	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	8.16e-25	40	329	31	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.48e-24	40	329	21	326	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	6.61e-67	48	362	29	339	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	4.47e-24	40	329	31	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	5.72e-12	50	324	92	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_01706.