CAZyme Information: MGYG000003684_02881

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_02881
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	MGYG000003684_9|CGC4	80030.6	4.8454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 141017; End: 143146 Strand: +

Full Sequence      

MKNWHWIQGDNECESPLFRRSFSLRELPASAKLEICGLGYFLLYVNGRRACDQEFVPAFT
NYSSVLGCDTTYPVWEERSRYRCLYLTIDLLPFLKTGENVLGIQLGNGWYHQTKRVDEGK
FIFGFPKLRYELHMLTSEGEEVVIESDPKTLWKPGEVTENNLFYGETQDLRLLQEDWCME
SADVAGWKPARPVHAPETILEEQKCPADRVLRQIQPVLLEDKCGRKLYDCRENIAGWAEI
RCLGKTGEQVSVRYSEELTDDSCLDFRSAGGERQIQKDSYICNGSPVTVRPKFCWHGFRY
FEVEGAGEAVSVSVVGTQAPAVSSFRCSNPVLNWLYDAYIRTQSANFHNCIPSDCPHREK
LGYTGDGQLTSETAMLTMDTRRLYEKWYQDILDSQGADTGHIPHTAPFMGGGGGPGGWGC
AVYVVPMDYWRVFGDSALLEKGYPAIFRWLEYMESRCEKGLVVREEEGGWCLGEWCAPEA
EPEKLPEAFVNTCFYIQGLQALGQITQILHKEEPEWVKDRILTAKKAVMDTFFDANTGDF
CGGTGAANAFALNVGLGTAGTKKNLVDRYRKLGRLDTGIFGTPVLLEWLFKVGEADLAFR
LLTNDNEVSFANMMRSGATTLWEKWDGADSHNHPMFGNVVKLLFTEVLGIRQKEGTCGFA
EYYVMPADIKGLDWAQGTMRTAAGLISVKWNRDEDGRMQVDSWEAGSEK

Enzyme Prediction     

No EC number prediction in MGYG000003684_02881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	223	700	5.7e-121	0.9603174603174603
CBM67	6	197	4e-19	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.26e-78	322	647	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.68e-43	28	210	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.80e-13	224	315	6	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.001	649	701	1	50	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	7.65e-214	6	689	8	684
BCJ98018.1	2.76e-174	6	694	127	839
QOY86540.1	2.76e-150	9	700	145	828
QUT50058.1	2.82e-141	15	704	161	843
QMW80401.1	3.45e-125	6	694	127	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.08e-70	15	695	176	880	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.03e-68	19	696	306	977	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.05e-57	18	690	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	9.99e-68	18	694	187	887	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.00e-67	19	696	306	977	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.41e-59	10	690	168	855	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.92e-51	19	696	174	861	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	7.15e-14	298	693	700	1115	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_02881.