CAZyme Information: MGYG000003684_05549

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_05549
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1487	MGYG000003684_39|CGC1	169974.27	6.0461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 25200; End: 29663 Strand: +

Full Sequence      

MNDSKNIISYSKEALLRNGVPWFPVMGEFHYSRYPAGMWEEELCKMKAGGIDIVSSYIFW
IHHEEEEGKYDFSGNRDLRGFLHAAKSAGLLAFLRIGPWCHGEVRNGGLPDWVMHKEYEV
RSNDTAYLQDVKAYFSKLGETIRGLTWEDGGPVLGIQIENEYGCCGGLTGEEGEKHMRCL
TDMAVNAGLKAPLMTATAWGGACTGGLLPVMGGYCDAPWAREIEKLPPNVNYVFTPERND
ANIGSDFGKKETAGKKEEFPYLMAELGGGLQPTKHRRPVASAADIGAMSLVKLGCGANLL
GYYMYHGGSNPEGRNTTLQETKKTGSWNELPAYNYDFQAPVGEYGQVRESCREIKLLSMF
LHDFGSGLCTMKPEFPSPVMDDAGNLETLRTCVRHNGERGYLFVNNYQRLYPMKEHRNAV
LHAKIGTNELYYPARDIRNGDYFFYPFNMPIGESAEIVTALATPLCILHRRNEKIYVFYS
DTEPMYRIKGDLGRNKIVTLSRREALDAWKVEINGEEYLLITGGEIREQKGQIILRGIVD
EENRKTEFASCPALPESPAGFKKIREEKLAYYERKEKKERTKVFWKQGRLEKGFREYELS
VEYPQESMQECYLRVDYEGDSAELRIGDNVYADHFYTGQVWEIGMKRYHFPVSAKLRIHP
LKESAPVYLERQPVMENGRAQRLKNIAVKEACEYVLWERKEESHFLAPFQGQEMTDIALH
FKWTKKAGSEAVEYVLELADNQEFVNAQEMEATILSDSEVGYYFPKTEELPYYEGIWHAR
VREKNGGSWSRPVSFYINKKHGKKPVKREINRENPWFTIFDYSEHDPAEVWMLLPEELKP
YTGMGLIASYKARADRVIDYMLDEDAKGYLWHLGALGPHETQFGKYTITSLSEIEYVIQH
SRNLVSIGFVEQYLGTKEEGYWRNEYFFRLLALCAKYGIVFIYSDGNRNNLELAAMIKRP
FFMNKMREYADYFIFSYKQNHAHAAYSCFGALLGAWIDGACSQIGVQPENWYWNDAGFRD
KPGECYGYLQGNEQQITACMTVEMLLTGLSLGAVNYSCEGESWLIERGPQDKLIWSAQGL
AVISFFRAVILYKLIPDKTEIQKKIRAAVDYEGFMPEALGDAWTGGILREAFMPGYRIQN
QFELFPKESRFYYLPLVTDRQQAFAGMAKLYAGSVSSMEAYEALCRHYPSEAEGNAYYAV
FQELMVIMHSQENEEEAQWFSIPGKDGFLLQIRGALSLWQYIIVRSHKTGCYIHVNSERG
KNIRFSLRLASRPVWSSNSENISLVWKDGWLEAVVKGDGLPVEFTVADRQEEMAALVPQY
HNKEEKKLQLLSELPWTYAETSQNCPVQKNACANTAYGRLPLAVGHLRYRYGLSMGNHTR
IVWKLNGKYRRLSFGYGFDIDAWMPKILDRDNILWDRAEKTICMRLQLIGDGRKLFSSPR
LTGTGGTYIGEADLTDVNRLEIIVDGEVFSEDPGAGVYLDFLNPVLA

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	15	357	6e-88	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	8.82e-54	14	357	1	314	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.67e-33	8	349	30	329	beta-galactosidase; Provisional
COG1874	GanA	2.20e-17	8	166	1	165	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08306	Glyco_hydro_98M	3.65e-13	807	1024	8	253	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam08305	NPCBM	1.27e-12	1331	1486	5	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68119.1	3.10e-245	9	688	7	681
ADZ82426.1	1.55e-242	9	688	7	681
ACZ98631.1	1.38e-239	10	689	8	679
BCJ96076.1	2.23e-234	9	685	7	676
BCN30566.1	2.79e-228	1	683	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	3.55e-31	8	163	18	174	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	3.08e-30	8	163	11	167	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.57e-30	8	163	35	191	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	8.31e-30	8	163	35	191	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
6EON_A	3.93e-29	4	379	24	363	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SCV9	2.16e-35	8	516	33	516	Beta-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BGAL3 PE=2 SV=1
Q8GX69	6.36e-33	8	349	25	325	Beta-galactosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGAL16 PE=2 SV=2
Q10NX8	2.95e-32	8	349	33	332	Beta-galactosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0255100 PE=1 SV=2
P48980	4.38e-31	8	349	24	323	Beta-galactosidase OS=Solanum lycopersicum OX=4081 PE=1 SV=1
P23780	2.20e-30	8	163	35	191	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_05549.