CAZyme Information: MGYG000003686_01005

Basic Information

• Species: ER4 sp000765235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; ER4; ER4 sp000765235
• CAZyme ID: MGYG000003686_01005
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		44664.93	6.9614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003686	3367407	Isolate	China	Asia

• Gene Location: Start: 1929; End: 3074 Strand: +

Full Sequence      

MRRKPHRDTYIKGGIIISYRVCVYAICKNESQFVERFMDSMSEADDICVLDTGSTDDTVE
KLRARGAHVEQKVISPWRFDVARNKSLMLIPKDADICCCIDLDEQFRSGWREKLERAWQP
DTTRARYRYTWSFLPDGREGCVFWTDKIHKNGCYRWVNPVHEVLQYLGEGGERFVDAEGV
QLDHHPDPSKSRGQYLPLLELAVREDPQNDRNRHYLGREYMFRGEWAQAVSTLKAHLAMP
QAVWRDERCASMRYIARCLRRLEREDEAALWLHRAIAEAPYLREPYLEFADLLYQQKDWC
GVIFMVNCALAITERPRTYICEPFAWGSFPYDLLSIAYFHLSQWESALKNAEKAFALAPD
DARLQENCALLRAKIQKESRI

Enzyme Prediction     

No EC number prediction in MGYG000003686_01005.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.40e-13	20	227	1	208	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
COG0463	WcaA	1.01e-06	20	294	4	274	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	4.63e-05	214	299	5	85	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR04195	S_glycosyl_SunS	1.75e-04	26	107	64	153	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
COG0457	TPR	2.06e-04	201	377	86	251	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA29496.1	2.35e-154	20	371	2	354
ANU42689.1	6.32e-152	20	371	2	354
QQR04409.1	6.32e-152	20	371	2	354
AQS58819.1	6.92e-147	20	376	5	361
AQS58818.1	4.34e-140	20	379	5	364

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003686_01005.