CAZyme Information: MGYG000003686_02238

Basic Information

• Species: ER4 sp000765235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; ER4; ER4 sp000765235
• CAZyme ID: MGYG000003686_02238
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000003686_21|CGC1	42934.29	6.4896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003686	3367407	Isolate	China	Asia

• Gene Location: Start: 31332; End: 32510 Strand: +

Full Sequence      

MSKIVFFCIPAYGHTNPTLGVVRELTARGHEVRYYSYEPMRTLIEAAGAQFVACDPYDCE
QHLTPADGARIGKDIAFSTHILVETTLALDEMVCADMRAYAPDCIVADSMAVWGKAVAKK
LGIPFISSTTTFAFNRYSAKVMKQSGGQMLKMMLAMPKINHDLQRLRDRGYPIKNILDII
QNDDRTDTIVYTSPEFQPCADTFSDKYAFVGPSIRPATETVEKVHDVLIYISMGTVNNDL
LPFYRACIAAFVDSPYQVILSTGEQIDRSALGTLPDNITALPHVDQIAVLQKADVFLSHC
GMNSASESLYFGVPLVLFPQTNEQGGVAARVAELGAGLKLEKADAASIRTAVNAVLQTPS
YRANAQNIRESFLRCGGAKAAVDRILSVADRR

Enzyme Prediction     

No EC number prediction in MGYG000003686_02238.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	10	389	2.3e-50	0.9842931937172775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	2.08e-99	7	386	1	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	3.19e-71	1	392	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	3.32e-67	3	381	2	398	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	1.76e-12	13	388	11	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PHA03392	egt	8.59e-09	214	369	280	443	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK99922.1	2.76e-154	1	390	1	390
QWW19688.1	5.86e-147	1	386	1	387
AVP65214.1	1.53e-137	1	390	1	388
AJD26746.1	1.24e-136	1	390	1	388
AKC62778.1	1.76e-136	1	390	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	4.88e-51	9	385	11	381	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	5.49e-51	9	385	11	381	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
3RSC_A	2.38e-40	2	385	21	408	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	2.42e-40	2	385	21	408	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
2IYA_A	1.45e-39	4	383	15	414	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	2.45e-53	1	392	1	399	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O05496	2.88e-52	1	385	1	386	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
O34539	3.01e-50	9	385	11	381	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	3.82e-47	2	385	4	386	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q9XC67	1.45e-37	1	385	58	453	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003686_02238.