CAZyme Information: MGYG000003687_00812

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_00812
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		33007.05	10.1259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 299872; End: 300765 Strand: -

Full Sequence      

MSSKRSRWLTRFTLSATTAITIFTAFTSYLAAPAAATGVAFRDISHSYAYQSIISLHAKG
ILNGTQPGYFSPKKAVTRAEWVTALDRVLALKPVQAAVSSYRDVPKQAWYYGWIEAASQL
DIVQGGTSGTFQPNSPITRQEAALMIARLIRSSGGSGSTTSSFTDRDEIADWALEGVTTV
NRYGFMKGENNYFHPASSLTREETAALLERLLTYSTQHARQAASTASSIRLGWQYDQTVQ
QFQNTVLQSNINTLSPRWFFLNETGSISDYSNSSLLTWSKQHQKKSGLWWATVPIWR

Enzyme Prediction     

No EC number prediction in MGYG000003687_00812.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00395	SLH	6.72e-11	101	142	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	1.62e-10	40	143	642	745	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	8.81e-07	41	80	1	41	S-layer homology domain.
NF033190	inl_like_NEAT_1	3.63e-06	94	212	575	691	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
NF033190	inl_like_NEAT_1	5.00e-05	39	213	580	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM65248.1	7.26e-199	1	293	1	290
QPK56364.1	1.13e-195	1	293	1	290
QPK51271.1	1.13e-195	1	293	1	290
QDA25537.1	4.57e-195	1	293	1	290
AUS25798.1	6.48e-195	1	293	1	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT4_A	9.85e-13	38	210	23	194	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	1.00e-12	38	210	2	173	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6CRV0	4.89e-19	48	211	1291	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P19424	1.90e-15	41	218	41	220	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
P38537	9.44e-14	41	212	36	206	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
P49051	1.22e-12	21	210	14	202	S-layer protein sap OS=Bacillus anthracis OX=1392 GN=sap PE=1 SV=1
Q9ZES5	4.17e-11	21	210	14	203	S-layer protein OS=Bacillus thuringiensis subsp. finitimus OX=29337 GN=ctc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026951	0.960892	0.003219	0.008073	0.000497	0.000335

TMHMM  Annotations     

start	end
12	34