CAZyme Information: MGYG000003687_01020

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_01020
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000003687_3|CGC4	37247.81	5.6614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 100392; End: 101372 Strand: -

Full Sequence      

MLVGKESFCDFHTIQEAIHVLEQSPSNEMETLTILSGTYEEEVRIYRSNLHIIGIGQVEI
HMDRYAKERNEAGEEIGTFATPTLFIGGSHLILENLIISNTAGQGEHIGQAVAVYAHCDQ
TVFRNCTFKGYQDTLFTGPLPPAPKERLKFGGIPLKEHHAHYRQLYQHCYIEGTIDFIFG
GATAYFEDCEIRSLRHHKNHTSYVTAASTPQGQTYGYVFDHCYLTAEPDITPVFLGRPWR
EYAKTVFVDCKMGDHIDPRGWDNWDNVANEKTVCYQEYGGSDEIALLRKQRVPWADCFEA
RTEAWSKEQVFEGVTFWKVRRSDVSC

Enzyme Prediction     

No EC number prediction in MGYG000003687_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	304	6.2e-84	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	3.93e-61	3	295	4	275	Pectinesterase.
COG4677	PemB	6.50e-60	10	290	93	387	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	6.85e-48	3	295	245	526	Probable pectinesterase/pectinesterase inhibitor
PLN02217	PLN02217	3.33e-46	1	295	252	525	probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	5.15e-46	10	295	16	279	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY07754.1	1.88e-252	1	326	1	326
AUS27529.1	1.88e-252	1	326	1	326
AHM66949.1	1.88e-252	1	326	1	326
QPK54296.1	1.09e-251	1	326	1	326
QPK59387.1	1.09e-251	1	326	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.68e-33	2	294	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	9.54e-31	1	294	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	2.45e-27	11	281	19	262	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.26e-26	11	281	19	262	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.51e-20	3	290	7	319	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3E8Z8	9.72e-38	1	294	253	525	Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana OX=3702 GN=PME28 PE=2 SV=1
Q8GX86	9.88e-38	1	295	256	529	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q8L7Q7	9.93e-36	4	295	296	575	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O04887	5.43e-35	1	278	203	457	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
Q9LXD9	2.15e-34	3	295	243	524	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_01020.