CAZyme Information: MGYG000003687_01870

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_01870
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
974		105355.51	5.736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 161042; End: 163966 Strand: -

Full Sequence      

MKKMILCLLSASLICLAAPVSTKAFSGEVTQGTGSYSTTLPAGAATPQNEIYKTANVTSP
MPTNDWWSSLAWVPYSEAQYPHPLALKNQQNGLRIFNPSGKITVNPGYIAGWMDDVNDFT
IGHSESASFPDAKVDAFNDWFVKSLFQSGSNKMSATYGHGSPYVFFEFGGGNPKLSFNEV
PKVWSGSASSPVLGITINGSHYGLFAPSGSTWSGLGTSTLINQLNGKNYFTVAALPDNTT
ATLDKFQQYAYSFVTDSKAQYSYNEASSEVTTTFTVTTTAKQGTQAGTIFALYPHQWKNS
SQSLLGYTYNSVRGLMKTAEGASFQTKMKFTGVLPSLPDLGSYDKNKLNSYIDEAKAEVY
SGDGDTYWTGKRLGKLAALAPIADQVGNTAAATQFRNEIKSRLQDWFKASDSSGNLKISN
LFVYNSNWGTLIGYPDSFGSAVELNDHHFHYGYFIKAAAEIARVDKSWASNSQWGQMVQL
LIRDIANTDRSDSKFPYLRNFDPYAGHTWASGHAKFGDGNNNESSSEAMNAWAGLILWGE
ATGNTQTRDLGIYLYTTEMNAINEYWFDVQGTNTPSGMQSATASMIWGGKTVGNATWWTN
NPAEVHGINWLPITSASLYLTQYPEYAAKNFSNLLQKSGGDFSPWEDIVYMYRAISDPSD
AKAKFSAHVAAMTPEAGNSKANAYHWIYNLDAVGNIDRSVTANSPIYAVFHKNGVKTYVA
YNFTNQEKIVTFSDGHSITVQPNSFNIGNGNGGGNPQPDIEAPTSPANVRATAKTASAVT
LEWEAATDNVGVTGYIVYKDGTQAAEISGTSASITGLNAATAYSFTVKARDAAGNLSAAS
RAVSVTTEAASGGNEGGGETEDYTVRARFVSDREALIQFTPKTASVYVDVHYTLAGGQQL
NYRMTNNAGVWEQRVKDLTIGKAVSYWFTYEKAGLQYETPSFSYTHQTASTTAGVSEISA
TEALDTSQPGLAPE

Enzyme Prediction     

EC	3.2.1.39

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	47	686	3.5e-161	0.9903536977491961
CBM56	811	951	6.7e-41	0.9874213836477987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5498	Acf2	6.91e-131	8	697	24	758	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
pfam17652	Glyco_hydro81C	4.95e-53	367	667	32	331	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
cd00063	FN3	2.84e-12	763	847	1	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	7.97e-10	763	834	1	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
COG3979	COG3979	5.39e-09	759	847	1	90	Chitodextrinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA27590.1	0.0	1	974	1	974
AUS28653.1	0.0	1	974	1	974
AHM68014.1	0.0	1	974	1	974
AIY08720.1	0.0	1	974	1	974
QPK58453.1	0.0	1	974	1	974

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FOP_A	6.43e-262	31	750	5	716	ChainA, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5T4A_A	1.61e-233	29	758	24	780	ChainA, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4C_A	4.55e-233	29	758	24	780	ChainA, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5V1W_A	1.45e-231	29	750	4	752	ChainA, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5UPI_A	4.25e-231	29	750	4	752	ChainA, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9UT45	3.96e-35	122	667	152	713	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
P53753	1.00e-28	246	666	647	1086	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
Q12168	3.09e-28	310	658	381	745	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
Q5AIR7	1.50e-24	274	668	703	1118	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
D4AZ24	2.10e-24	358	658	565	869	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000325	0.998858	0.000195	0.000222	0.000197	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_01870.