CAZyme Information: MGYG000003687_01909

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_01909
• CAZy Family: GH11
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212	MGYG000003687_6|CGC4	23171.57	9.5816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 203969; End: 204607 Strand: -

Full Sequence      

MIKFSKKMLTVVLAASMSFGVFATTSSAATDYWQNWTDGGGTVNAVNGSGGNYSVTWKDT
GNFVVGKGWTTGSPNRTINYNAGVWAPSGNGYLALYGWTRNSLIEYYVVDSWGTYRPTGT
YKGTVTSDGGTYDIYTTMRYDAPSIEGQKTTFIQYWSVRQTKRPTGGNSTITFSNHVNAW
ASKGMHLGNNWSYQVLATEGYQSSGSSNVTVW

Enzyme Prediction     

EC	3.2.1.8	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	31	210	1.8e-70	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00457	Glyco_hydro_11	3.46e-84	31	208	3	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA27556.1	9.91e-157	1	212	1	212
QPK58421.1	9.91e-157	1	212	1	212
AIY08752.1	9.91e-157	1	212	1	212
AUS28690.1	9.91e-157	1	212	1	212
QPK53338.1	9.91e-157	1	212	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XXN_A	9.29e-123	28	212	1	185	Crystalstructure of a mesophilic xylanase A from Bacillus subtilis 1A1 [Bacillus subtilis],2DCY_A Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_B Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_C Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_D Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_E Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis]
7KV0_A	1.94e-122	29	212	4	186	ChainA, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans],7KV0_B Chain B, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans]
1BVV_A	2.66e-122	28	212	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans],1XNB_A Chain A, XYLANASE [Niallia circulans],2B42_B Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_B Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_D Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis]
2QZ3_A	7.63e-122	28	212	1	185	ChainA, Endo-1,4-beta-xylanase A [Bacillus subtilis],2QZ3_B Chain B, Endo-1,4-beta-xylanase A [Bacillus subtilis],2Z79_A Chain A, Endo-1,4-beta-xylanase A [Bacillus subtilis],2Z79_B Chain B, Endo-1,4-beta-xylanase A [Bacillus subtilis]
1HV0_A	1.08e-121	28	212	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45705	2.42e-128	3	212	2	210	Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=3 SV=2
V9TXH2	3.44e-128	1	212	1	210	Endo-1,4-beta-xylanase Xyn11E OS=Paenibacillus barcinonensis OX=198119 GN=xyn11E PE=1 SV=1
P18429	6.34e-127	1	212	1	213	Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) OX=224308 GN=xynA PE=1 SV=1
P09850	1.82e-126	1	212	1	213	Endo-1,4-beta-xylanase OS=Niallia circulans OX=1397 GN=xlnA PE=1 SV=1
D7EZJ3	3.72e-78	32	211	67	239	Endo-1,4-beta-xylanase B OS=Streptomyces sp. OX=1931 GN=xynBS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999115	0.000166	0.000186	0.000160	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_01909.