CAZyme Information: MGYG000003687_02609

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_02609
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		58420.41	9.0321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 32806; End: 34413 Strand: -

Full Sequence      

MMNRQWILPRIAKRVAVLLTAVLLLTLTNGFNWNASTAEAAGTTPVERYGQLSVKSGKLV
DKNGQPVQLKGISSHGVQWFGDLVNQDTMKWLRDDWGISVFRVALYTEENGYIANPSLKN
KVKEAIEAAQKLGLYVIIDWHILSDGDPNIHKNEAKAFFNEFSTKYGHLPNVIYELANEP
NGNVNWNNQIRPYASEVSQVIRAKDPDNIIIVGTGTWSQDVHDAADHPLPDKNTMYTVHF
YAGTHGQYLRDRVDYALNKGVGIFATEWGTSDASGNGGPFLNESKVWTDFLASRKISWAN
WSLADKNETSAALLPGADRKGGWPDSQLTASGKFVKQAILEGSSSHGGGSNGGNNGGDGN
NGGSNDGGNSGGNNGNDHSGSTPGGNNEGIVLQYRTDDTNAKDNAIRPQFNIKNTGKTAV
KLSDLKIRYYYTDESKQAQQFFVDWAKIGNEKVKATFVTLPNPKVKADKYVEISFTDGAG
TIQPAAKLGKFNPVFMLQIGATLMRPTITPMVLPKQHSQTGTMAPYISKVSWYGV

Enzyme Prediction     

EC	3.2.1.4	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	62	300	7.2e-94	0.9957805907172996
CBM3	393	474	7.6e-28	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.59e-77	60	307	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.99e-28	35	308	30	280	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00942	CBM_3	6.75e-26	392	473	1	82	Cellulose binding domain.
smart01067	CBM_3	1.07e-21	392	474	1	83	Cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK53913.1	0.0	1	492	1	493
QPK59000.1	0.0	1	492	1	493
QDA28171.1	0.0	1	492	1	493
AIY08152.1	0.0	1	492	1	489
AHM67382.1	0.0	1	492	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	9.79e-171	42	339	3	300	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	2.04e-151	38	340	22	325	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
1LF1_A	4.75e-145	46	344	6	305	CrystalStructure of Cel5 from Alkalophilic Bacillus sp. [Bacillus subtilis]
1E5J_A	1.72e-144	46	344	6	305	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]
1A3H_A	5.82e-144	46	341	3	299	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47096	4.46e-190	40	490	29	457	Endoglucanase 5 OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=celV PE=1 SV=1
Q59395	7.27e-189	40	490	29	457	Endoglucanase 6 OS=Pectobacterium parmentieri OX=1905730 GN=celV1 PE=3 SV=2
Q59394	5.69e-183	40	474	29	444	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1
P10475	9.41e-173	13	492	3	453	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	3.07e-171	13	492	3	453	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001002	0.944644	0.053300	0.000517	0.000287	0.000203

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_02609.