CAZyme Information: MGYG000003687_03095

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_03095
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
170		18307.48	6.7016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 144395; End: 144907 Strand: +

Full Sequence      

MTDVHDAFPDKPVYMTECSGGAWSPGFGDDLSWDMSKLIIGAPRNWSQNVLFWNIALDPS
GGPTNGGCTNCRGVVTIDPLSGAVTKNVEYYAIGHASKFVRPGAVRIDSTHYSGSIETVA
YRNPDGTLVLIAANTGENTKTFKVRQGNQVFKSTLPSKSAATFQWEPTTS

Enzyme Prediction     

No EC number prediction in MGYG000003687_03095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	1	165	2.8e-66	0.39568345323741005

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	1.68e-33	10	166	263	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	2.61e-15	103	163	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
pfam02055	Glyco_hydro_30	5.23e-06	1	100	245	348	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA26071.1	1.96e-122	1	170	336	505
AIY10252.1	6.40e-121	1	170	336	505
AHM64615.1	6.40e-121	1	170	336	505
AUS25181.1	6.40e-121	1	170	336	505
AZH28179.1	1.82e-120	1	170	336	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NGK_A	5.00e-31	1	165	321	490	Theendo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_A The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron]
2WNW_A	1.19e-16	39	165	317	442	Thecrystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],2WNW_B The crystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
7O0E_A	5.90e-12	12	136	266	388	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	3.79e-11	12	136	273	395	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	1.61e-06	69	144	334	407	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WBR2	1.29e-20	1	163	321	483	Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=neg1 PE=1 SV=1
Q8J0I9	1.16e-19	1	163	323	485	Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum OX=5544 PE=1 SV=1
G2Q1N4	3.29e-11	12	136	290	412	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
O16580	2.88e-10	1	141	342	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
O16581	9.76e-10	1	134	342	479	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999994	0.000047	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_03095.