CAZyme Information: MGYG000003687_03816

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_03816
• CAZy Family: CBM42
• CAZyme Description: Extracellular exo-alpha-(1->5)-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155		18565.04	8.4442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 108132; End: 108599 Strand: -

Full Sequence      

MAWSTFGSFNYPDRFIRHRNFLGELDLLRMNSSDSDKMDATFNLEWIDESRNLARLRSYN
FPNYFLRHQGFQIKLHPDNPADPLMQADSTFIVEQGLAYPYGWEFISFRAINLPPRHYIR
HRNFHLYVDFIPQNDQLALKDSTFRITAKPAIMWR

Enzyme Prediction     

No EC number prediction in MGYG000003687_03816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM42	8	145	6.7e-26	0.9558823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05270	AbfB	7.83e-28	8	146	5	137	Alpha-L-arabinofuranosidase B (ABFB) domain. This family consists of several fungal alpha-L-arabinofuranosidase B proteins. L-Arabinose is a constituent of plant-cell-wall poly-saccharides. It is found in a polymeric form in L-arabinan, in which the backbone is formed by 1,5-a- linked l-arabinose residues that can be branched via 1,2-a- and 1,3-a-linked l-arabinofuranose side chains. AbfB hydrolyzes 1,5-a, 1,3-a and 1,2-a linkages in both oligosaccharides and polysaccharides, which contain terminal non-reducing l-arabinofuranoses in side chains.
pfam05270	AbfB	1.20e-15	55	148	2	91	Alpha-L-arabinofuranosidase B (ABFB) domain. This family consists of several fungal alpha-L-arabinofuranosidase B proteins. L-Arabinose is a constituent of plant-cell-wall poly-saccharides. It is found in a polymeric form in L-arabinan, in which the backbone is formed by 1,5-a- linked l-arabinose residues that can be branched via 1,2-a- and 1,3-a-linked l-arabinofuranose side chains. AbfB hydrolyzes 1,5-a, 1,3-a and 1,2-a linkages in both oligosaccharides and polysaccharides, which contain terminal non-reducing l-arabinofuranoses in side chains.
pfam05270	AbfB	1.58e-13	5	93	52	137	Alpha-L-arabinofuranosidase B (ABFB) domain. This family consists of several fungal alpha-L-arabinofuranosidase B proteins. L-Arabinose is a constituent of plant-cell-wall poly-saccharides. It is found in a polymeric form in L-arabinan, in which the backbone is formed by 1,5-a- linked l-arabinose residues that can be branched via 1,2-a- and 1,3-a-linked l-arabinofuranose side chains. AbfB hydrolyzes 1,5-a, 1,3-a and 1,2-a linkages in both oligosaccharides and polysaccharides, which contain terminal non-reducing l-arabinofuranoses in side chains.
pfam05270	AbfB	8.42e-09	3	44	98	137	Alpha-L-arabinofuranosidase B (ABFB) domain. This family consists of several fungal alpha-L-arabinofuranosidase B proteins. L-Arabinose is a constituent of plant-cell-wall poly-saccharides. It is found in a polymeric form in L-arabinan, in which the backbone is formed by 1,5-a- linked l-arabinose residues that can be branched via 1,2-a- and 1,3-a-linked l-arabinofuranose side chains. AbfB hydrolyzes 1,5-a, 1,3-a and 1,2-a linkages in both oligosaccharides and polysaccharides, which contain terminal non-reducing l-arabinofuranoses in side chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM64365.1	6.40e-107	1	155	1	155
AIY10035.1	6.40e-107	1	155	1	155
QCY64656.1	1.70e-56	1	154	1	153
CCK26758.1	1.44e-19	4	129	62	195
BAY58154.1	3.77e-10	4	144	44	186

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_03816.