CAZyme Information: MGYG000003687_04121

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_04121
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	MGYG000003687_20|CGC3	33577.75	9.7701

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 56173; End: 57057 Strand: -

Full Sequence      

MEKNYKSKWDGKAARSTWKSKDGVELGTFDNEATTTEIRFLADVYKKTKNKDIKNSVQKA
VDFVLTSQYSSGAWPQVYPKRGNYSDAATYNDDAMVRVMVLADDIVNKRQPFDSDILDNT
YRSRLQQALNKGVQYTLKAQIVNNGTPTIWGAQHDPVTYESVPARAFELASKTTTESVGI
TAFLMSQPQTTEVKKAAQSALKWFDTNRIDGMKYNRQGPEFFQKDASSVMWYRFYNVEDN
KYFFSDRDGKKYTDIMKISEERRLGYAWAGSQAKSLLKLASESGYYKLSKPLPQ

Enzyme Prediction     

No EC number prediction in MGYG000003687_04121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	4	276	1.4e-98	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.02e-123	3	277	9	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	4.57e-113	5	277	17	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM65322.1	3.79e-214	1	294	109	402
AUS25880.1	3.79e-214	1	294	109	402
QDA25464.1	5.38e-214	1	294	109	402
AIY10846.1	2.19e-213	1	294	109	402
AJE50256.1	6.26e-213	1	294	109	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GXM_A	1.30e-78	23	285	65	331	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	2.08e-77	23	285	65	331	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]
1R76_A	2.05e-50	19	268	136	389	ChainA, pectate lyase [Niveispirillum irakense]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_04121.