CAZyme Information: MGYG000003687_05378

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_05378
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	MGYG000003687_38|CGC1	69878.13	5.0992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 27174; End: 29000 Strand: +

Full Sequence      

MELSKGMRPNSGVGLTPQEIQYYFRDVYDSGDKLVISEPNLICELSSRFAMNQEYEGVLD
PEGPIRLIAPPGPGVPTETRGSVQLMLEYDGTLTADGYRLDIQKEGRIEIHAFNKRGLKY
GMDALHLLLQVEQERCTLPVISIRDEPSFPVRGIIEGFYGKPWSFADRLDAVRFMATHRM
NTFMYAPKDDPYHRELWREPYPEETFAQIRELKEACERHEIDFHYCISPGNDLNFGSAED
FLKLTEKLAAMIAIGVRHFSVLMDDIDYVLKGENRHLLGRSGHAHVFLTNKVHTWLAERL
PEFTLTVCPSEYWSYWDTEYKKDFRERLHPEIKVFWTGYFVFAPQIGRQHAADNHAFYGH
ELWLWDNIPVNDCDHDQLFLDPLRGRYSGLPACGHTGMVANPMNQWECSKVTLITMSHYM
WNSERYMPGLSWEWAVRELAGEHADELMFFCRQNKNSRLGSSTYEDVDLALQMRDIPALD
IYFERLLHVVSVLQNISANDAAAGFVAQATPWLERAKLDVDLWHVLRQTALGNERQNDVQ
SLGNLMQSEATGGQKPQPLTDEVVDELRRGITACLEAETRLGSNPAIRAAVQWGYVNQDE
QGKYRLIL

Enzyme Prediction     

No EC number prediction in MGYG000003687_05378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	152	451	1.9e-107	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.11e-144	152	450	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
COG3525	Chb	1.31e-05	69	205	187	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK57501.1	0.0	1	608	1	608
AHM64054.1	0.0	1	608	1	608
QDA26594.1	0.0	1	608	1	608
AIY09750.1	0.0	1	608	1	608
AUS24589.1	0.0	1	608	1	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	9.89e-65	96	459	130	493	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2XPK_A	7.96e-62	93	498	98	490	Cell-penetrant,nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens],2XPK_B Cell-penetrant, nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens]
7KHV_A	4.08e-61	93	498	98	490	CpOGAIN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_B CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_C CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_D CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_E CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens],7KHV_F CpOGA IN COMPLEX WITH LIGAND 54 [Clostridium perfringens]
2CBI_A	1.51e-60	93	498	98	490	Structureof the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
5OXD_A	1.94e-60	93	498	100	492	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XL08	4.86e-58	93	498	128	520	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	7.83e-58	96	522	100	529	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	8.98e-58	93	498	128	520	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8VIJ5	5.50e-44	153	417	63	329	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1
O60502	7.41e-44	153	417	63	329	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_05378.