CAZyme Information: MGYG000003687_05554

Basic Information

• Species: Paenibacillus polymyxa
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus polymyxa
• CAZyme ID: MGYG000003687_05554
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	MGYG000003687_45|CGC1	83477.35	5.5335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003687	5656034	Isolate	China	Asia

• Gene Location: Start: 20772; End: 22940 Strand: +

Full Sequence      

MGSRVIMPFRTDWKFIEGNYTGAEKTDYNDGHWQDLHIPHDWSIEKSFDPHMLYGGNQAY
LPRWSVGWYRKHFNVKPSSPKQRVYIQFDGIHSNSEVWLNGHFVGKRPYGYVSFQYDLTP
YIRWDEDNVIAVKVDNTLLPPDRWYSGAGIYRNVWLIYTDYLHVTEWGTTITTPEISPDE
AKVSARIKISNHHEHTVECTIKTEILDSQGQLKGKIENRVALAGFETEEIEQKTRVIEPE
LWSPDNPVLYEAQTTIYCDNTEVDRYRIPFGIREVILDSQKGLLLNGSSLKLKGVCIHHD
LGCLGAAYHDTAMKRRLEKLKEMGCNSIRFAHNPMAPELLDLCDHMGFLVVDEAFDKWKS
LSYEHVYDEWWAKDLEAMLVRDRNHPSVFMWSVGNEVENQGQPSMLNMLEHLVAFCHEKD
PTRPVTCALEPHNTPISLRDGSIEAKVEHTKLLAQRVDVLGLNYQEQWYEHYRAAMPDTL
ILGTETFPYYRGKDNRVKGYLPLNPWFDVANHDYVIGQFVWSGIDYLGETSYPSKGWSSG
LIDTCGFRKPVSYLQQSLWSDQPVVHIAVFNEYMKSEYNPTWTMHWKSPAMEDHWTFPEY
AGKLIRLVTFTNCESVELIVNEESYGERKLADYEVTLLDVRPRDEYETAHIPGAVSVPIE
ELAEQLSLLPADSKIVAYCRGPYCLMAVRAIELLQAHGFKARHLDKSVHDWNDFILNEVT
GS

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	594	2.5e-117	0.6569148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.06e-61	1	426	7	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.40e-54	68	469	68	476	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.70e-37	25	425	65	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.84e-28	66	425	121	485	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	7.39e-25	36	159	34	168	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY09981.1	0.0	1	716	1	705
AHM64308.1	0.0	1	716	1	705
QPK52200.1	0.0	1	716	1	705
QPK57286.1	0.0	1	716	1	705
AUS24860.1	0.0	1	716	1	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	9.07e-140	9	638	10	637	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	3.86e-139	9	638	10	637	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	7.90e-132	7	628	28	650	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
5T9A_A	6.60e-129	9	634	32	701	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	1.64e-128	9	628	6	636	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	5.23e-142	9	661	47	724	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.76e-103	4	629	46	668	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	7.83e-55	4	626	26	642	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	1.26e-54	4	393	3	384	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	2.84e-50	3	629	50	676	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003687_05554.