CAZyme Information: MGYG000003690_00036

Basic Information

• Species: Lactobacillus gasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus gasseri
• CAZyme ID: MGYG000003690_00036
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000003690_1|CGC2	42518.53	9.9057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003690	1974540	Isolate	China	Asia

• Gene Location: Start: 33051; End: 34169 Strand: +

Full Sequence      

MKVKNLILILGTIIAYLGIIAYVRMSNDRTLEERCYHSWREDYIKNKNQNEQYVNAAGRN
NPSFALSEAQGYGMLLAAKAGEKHLGSRIDFQKLDNYYLAHRLTNSNLMSWKQKDRKNIW
RDNPVSASDGDIIIAQALLHADRVWPGHGYKSQAVNLINDIKRLEINQKAKMVTVGNWAN
KDSRFYNVLRTSDVMPKAFEEFYQVTGDQAWLTIKRKMLNYLQKLSKKYNTGLVPDFAWI
SNNYVRPAQANEVAINDDGHYSANACRVPMLLAESNDKEAAQVVKKMLKFFKKKGTSAGF
TLKGEKLHHYQSASFSAPIFVAASKYRNQGYDTLIEQEKYIFSRPLPKDNYYDATLTVLA
ALNTNELTGLEK

Enzyme Prediction     

No EC number prediction in MGYG000003690_00036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	36	362	5.7e-72	0.98125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	2.27e-18	39	243	11	204	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.58e-14	60	363	48	343	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	2.92e-07	51	166	33	153	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH65510.1	1.32e-273	1	372	1	372
ABJ59494.1	1.32e-273	1	372	1	372
ASY54472.1	3.64e-271	1	372	1	372
QTP19686.1	4.28e-254	1	372	1	372
ART98164.1	4.28e-254	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	3.39e-33	38	323	68	364	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	2.09e-20	36	343	35	366	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	2.29e-20	36	343	41	372	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1KWF_A	1.90e-17	66	369	61	354	ChainA, Endoglucanase A [Acetivibrio thermocellus]
6VC5_A	1.85e-09	67	273	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	3.55e-32	38	323	68	364	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.07e-19	36	343	91	422	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	7.93e-17	66	369	93	386	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37701	1.54e-13	66	243	97	265	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P27032	3.46e-07	61	283	46	259	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.737250	0.256476	0.003440	0.000619	0.000410	0.001819

TMHMM  Annotations     

start	end
5	23