CAZyme Information: MGYG000003691_01076

Basic Information

• Species: Prevotella disiens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella disiens
• CAZyme ID: MGYG000003691_01076
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226	MGYG000003691_28|CGC1	26156.02	9.557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003691	2802053	Isolate	China	Asia

• Gene Location: Start: 22142; End: 22822 Strand: +

Full Sequence      

MKRYILIVLTFAVCLCSTIAGPTIRWNQTYQNYFDKYKNLAIKEMQRYGIPASITLAQGV
LESGAGQSKLAIVANNHFGIKCHDWTGRTISHDDDLTGECFRAYDTVLDSFEDHSKFLSG
RKRYNCLFNLSKYDYRGWAHGLKRAGYATNPQYAYKLIEIIEVYKLYQYDNAKFVEPFEP
TRPEITKKPTSKQNMLNTGLRNFRAFNENCYVTAHAVILTRILLKR

Enzyme Prediction     

No EC number prediction in MGYG000003691_01076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	166	1.9e-35	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.19e-39	31	173	44	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	6.32e-38	45	170	175	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.57e-36	24	170	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.82e-29	38	166	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	3.65e-23	49	162	192	317	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV52239.1	9.05e-105	1	216	1	212
APW33080.1	2.58e-104	1	216	1	212
ATV55604.1	3.67e-104	1	216	1	212
ATV39114.1	5.20e-104	1	216	1	212
ATV27433.1	7.38e-104	1	216	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.39e-13	31	161	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.85e-13	31	161	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.03e-12	31	161	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	3.75e-08	46	165	19	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.68e-08	46	165	19	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.56e-15	2	170	8	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.84e-12	31	160	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.87e-11	32	160	163	302	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	8.60e-10	40	168	249	389	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	1.17e-07	46	165	165	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000648	0.982926	0.015699	0.000239	0.000233	0.000223

TMHMM  Annotations     

start	end
5	24