CAZyme Information: MGYG000003693_00292

Basic Information

• Species: Phocaeicola plebeius_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius_A
• CAZyme ID: MGYG000003693_00292
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000003693_2|CGC2	43530.74	6.8168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003693	3967780	Isolate	China	Asia

• Gene Location: Start: 28090; End: 29232 Strand: -

Full Sequence      

MNNDILHIAFIGMGYRGKQLLSLIRHISGYHVTAIADPEAREEDYGVPCYNRGGEDYRRM
IKEQAPQLVFIASPWLLHVTHALYCIQKGCHVALEIKGGLCLNEYKPLIQAAESTGRKVF
PMENVLFRREVLALYRLVESGEMGEIVYMRGGYRHDLRSLLLDDHGRLGNRKKTESIWRS
KFYQQENGDLYPTHGLAPLCLIAGIPRKDRFVRLTTFSSKPAGLYQRIRELGGNPHVPVT
QGDVTVTQLETASGTLVSLTHDTTLPRPRSLDFEIQGTKGIWQGEQRRIYLEGKSPHETW
ETDTAYLQKYEHLYWQQWGEEALRIDTHHEGMDYIMLKALEAEMKQEIPYPADIHDLALW
TSVTPLSIQSVAEQRTVPME

Enzyme Prediction     

No EC number prediction in MGYG000003693_00292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	5	375	3.1e-111	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.09e-19	6	380	4	341	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.93e-14	6	120	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	3.25e-06	6	147	2	146	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	2.13e-192	4	377	8	382
QUT33801.1	6.28e-188	4	377	2	376
QQA30653.1	6.28e-188	4	377	2	376
QUT62197.1	6.28e-188	4	377	2	376
QRO24037.1	5.51e-158	9	377	7	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.04e-79	2	377	17	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	4.87e-47	6	380	43	429	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.12e-78	2	377	17	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	2.38e-73	6	372	34	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	3.76e-68	2	372	49	443	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.64e-65	6	372	50	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4FN60	4.81e-62	3	371	58	429	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003693_00292.