CAZyme Information: MGYG000003693_00317

Basic Information

• Species: Phocaeicola plebeius_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius_A
• CAZyme ID: MGYG000003693_00317
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000003693_2|CGC4	59705.4	4.3189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003693	3967780	Isolate	China	Asia

• Gene Location: Start: 66765; End: 68336 Strand: +

Full Sequence      

MKHILLYGSLMILVLSSLLSSCSSEEKSVIMPVLLQSNPENEAQEVDFALSEIVLTFNKK
VCMSASDLEKLQLSPSAQIENISFSDEIVTVQISGLTPETQYTLTIPGGLLIDDDNNSVG
EIKILFKTKALPVDKAPDNVGMENDAYALFKKIKVGWNLGNSLESYEDGLANHMDSETSW
GNPIVTKEMIDAVKNAGFNAVRIPVRWYPHVVDQNTMAEIRLDWLARVKEVVDYCIDNDM
YVILNTHHEDWLESHPLKSEAETVLMKEKNLWHAIASYFRDYDERLIFSGTNEVEINWQA
PTAANLEVQNRFNQCFVDAVRATGGKNYYRNLIIQTYATNPDYAFDGLLFPTDVVDKRMA
IEFHYYRPAGFSYMDFADYTETVYYWGQDYIQYNTVVSGEQEDYVDELFGKIKQLWVDKG
YPVVMGEYGVVTPPKDKSDGNVNDLADTKRYYMSYITSAAKKNGIVPIVWDNGTFYNPLY
DGPFVEGKEYFGLFNRWYQMEVNIYSRPILEGIMEGANTEYPF

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	176	473	1.1e-92	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.12e-48	174	473	13	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.35e-15	149	497	47	384	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam13205	Big_5	2.92e-04	32	110	5	87	Bacterial Ig-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55671.1	1.57e-106	137	503	132	478
QIK61079.1	8.79e-106	137	503	132	478
ADQ18612.1	1.06e-97	127	517	182	551
ASB50110.1	2.37e-95	137	518	220	574
BAF57333.1	2.61e-94	142	473	20	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OYC_A	6.34e-75	136	520	35	396	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	4.89e-74	136	520	35	396	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
6XSU_A	6.87e-63	146	515	13	351	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]
3ZMR_A	7.30e-62	125	481	93	447	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
4W85_A	1.01e-59	147	502	6	331	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	7.39e-61	125	481	128	482	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
O08342	1.02e-58	156	516	50	398	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P54937	1.53e-57	124	522	17	383	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P17901	6.30e-57	125	496	31	382	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P23660	4.59e-56	146	496	27	345	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000075	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003693_00317.