CAZyme Information: MGYG000003693_00870

Basic Information

• Species: Phocaeicola plebeius_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius_A
• CAZyme ID: MGYG000003693_00870
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		73701.16	6.5467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003693	3967780	Isolate	China	Asia

• Gene Location: Start: 49712; End: 51649 Strand: -

Full Sequence      

MKNLSLTLGLWVLGAAMCAAEPIELNLSSPEGIHKVKFYEKKSASGANVLCYEVNYNGKQ
VVKESQAGLQLDNRVWEMALGMRKLPQPACWMDNLEVDSVAYGSHDTTWTPLYGERSLVR
DNYRWGTLYLSKKDGSDYRLNVEVRAYDEGVAFRYYFPEHPKAIFHKVVGDLTEYTFPEG
TKAWAEQWAQAHFEYLDVNALKKPVERALTLELPNGVWAALTDADVDDWCLTKFQSSSEK
QHTLTSVMYSPVDIVTYYATPWKVIMAADKPGELLEHNYIIENLNPPCEIKNTDWIKPGK
IMRETSLTTDQALKTIDFCAEHRIPYMLFDWQWYMPCTSHDGDATKVVSKLNMPKVVAYG
KKKGVGIWLYVNQHALQKQMHELFPLLHKWGIVGVKSGFVQYASHRWATWLHDMVRLAAE
NNLMMNIHDEFRPSGFSRTYPNLLTQEGILGNEEFPDATHSTILPFTRMINGAADYTICY
YDKRLKNTHAHQLAASLVFYSPLMTIFWYDRPQFYNGEPEIEWFENLQTVFDESHVLDGM
PGKNITMARRKGKEWFVGMLTNNDGSVETLDCSFLDKNQMYLASIYTDGGEEVKTKTQVK
CSYVLVGAGDVIKFALKPRGGAAVRLVPVTEKEAKAYKKYNGESF

Enzyme Prediction     

No EC number prediction in MGYG000003693_00870.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	18	626	3.1e-163	0.9841521394611727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	1.54e-63	29	287	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	6.04e-57	293	520	2	269	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	5.30e-32	531	627	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ62032.1	0.0	1	643	1	645
QUT92217.1	0.0	1	643	1	645
QUU00177.1	0.0	1	643	1	645
QUT34121.1	0.0	1	643	1	645
QDO69864.1	0.0	1	643	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	3.56e-55	50	626	35	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	2.68e-54	50	626	21	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
3WFA_A	7.19e-44	52	588	26	663	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	7.25e-44	52	588	35	672	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	7.88e-44	52	588	46	683	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	5.62e-54	24	626	22	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	4.31e-43	52	588	46	683	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	4.75e-40	115	623	95	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999110	0.000169	0.000150	0.000137	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003693_00870.