CAZyme Information: MGYG000003693_01211

Basic Information

• Species: Phocaeicola plebeius_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius_A
• CAZyme ID: MGYG000003693_01211
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000003693_9|CGC1	43514.58	9.1248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003693	3967780	Isolate	China	Asia

• Gene Location: Start: 32716; End: 33867 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASNLMKALQAKDSKAEFRFFGGDLMATAGGSLVKHYKDMAYMGFI
PVLLHLRTIFRNMDLCKKDIVQWNPDVLILVDYPGFNLKIAEYIKAHTNIPIFYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVDFFKKYNYPIHYVGNPCVDAVHCFKQGYAESFEE
FTLRNGLDKKPIIALLAGSRKQEIKDNLQRMIQASRNYTEYQFVIAGAPGISPEFYQAYM
GDDTKIIFGRTYSLLSHATAALVTSGTATLETALFRVPQVVCYYTAAGKLVSFLRRHILK
VKYISLVNLIAGREVVAELVADGMTAENVKQQLEAILPGQMTREQMLQNYDALIKILGQE
GASERAAGKIVELLSQKYNRSLQ

Enzyme Prediction     

No EC number prediction in MGYG000003693_01211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	3.6e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.62e-104	1	377	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.35e-99	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.44e-73	4	367	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.75e-62	5	373	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.90e-47	1	374	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	5.53e-206	1	377	1	377
ADY36062.1	2.00e-200	1	382	1	381
AII64873.1	6.30e-189	1	376	1	379
AND19645.1	6.30e-189	1	376	1	379
QJR71433.1	6.30e-189	1	376	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.99e-32	5	373	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.99e-32	5	373	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.00e-63	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.57e-60	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.12e-58	5	377	11	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	2.33e-58	5	374	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q74AT9	6.64e-57	5	377	11	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003693_01211.