CAZyme Information: MGYG000003693_02462

Basic Information

• Species: Phocaeicola plebeius_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola plebeius_A
• CAZyme ID: MGYG000003693_02462
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	MGYG000003693_23|CGC3	46895.16	5.802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003693	3967780	Isolate	China	Asia

• Gene Location: Start: 71597; End: 72841 Strand: +

Full Sequence      

MGILKLLLNCCVAATVCGLGSCMKKAESTEKSWVEQAVENARCQIGLEIDTIEASGKVLN
PVTLNENEQVYYCGFSDWRSGFFPGSVWYLYELTDDNTLLSVAQKYTEALDEAKKLTWHH
DIGFIVNCSYGNGLRLSGKAEYKDVMIEAANSLCTRFREKPGTIQSWNVSGNSWQAQRGW
ECPVIIDNMMNLELLFEATKLSGDSTYYKIAVAHADRTLKEQFRPDGSCYHVIDYSLSDG
SVRHRHTAQGYSHESVWSRGQAWAIYGFTMCYRYTGDKKYLQQAIKTFNFMKNHKKMPED
LVPYWDMEAPKIPDEPRDVSSAAVIASALYEICTLGVPEAISYEEYADHIMASLASERYT
ARLGENGRFILMHSVGSIPHNSEIDVPLNYADYYYLEALKRKVDIEKSKNLALK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	76	401	6.6e-123	0.9756838905775076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.44e-11	77	399	28	336	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM67776.1	1.36e-227	21	408	5	391
QUU06876.1	1.60e-227	21	408	19	405
QQT78393.1	2.27e-227	21	408	19	405
QRP56362.1	2.27e-227	21	408	19	405
QCQ52148.1	2.68e-215	29	407	12	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	6.65e-101	4	407	1	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	7.69e-51	34	401	28	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	7.87e-51	34	401	29	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.10e-50	34	401	29	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	4.21e-50	34	401	29	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	8.12e-107	77	405	76	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	4.31e-50	34	401	29	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	9.71e-45	31	401	24	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	6.78e-43	60	401	32	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	1.51e-42	34	401	30	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000508	0.047132	0.952224	0.000035	0.000062	0.000043

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003693_02462.