CAZyme Information: MGYG000003694_00424

Basic Information

• Species: Agathobacter faecis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter faecis
• CAZyme ID: MGYG000003694_00424
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000003694_2|CGC1	39097	9.8169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003694	3443393	Isolate	China	Asia

• Gene Location: Start: 4676; End: 5719 Strand: -

Full Sequence      

MYLFHKKTKVLRVLALLCAFALGLCMTGGFQMTEAKTTYYDASAGRLHVKGTKLVDKKGH
EVQLRGVSTHGLSWYPQYVNDKCFAQLHDKWGANVVRLAMYTEEYNGYCSGDAKNRSDLK
KLIKKGVKLAKKHKMYVIVDWHILSDGNPNSHKKEAKAFFKEMSKELKGYNNVIYEICNE
PNNGTSWKEIKSYAKSVISTIRENDKKAVIVIGTPTWSQDVDQAAADPIKGDNIMYVLHF
YAATHKADLRNKMTAAINKGLPVFVTEYGICDASGNGAIDKKEADRWVQTMDEYGVSYIA
WNLSNKQESSSIIKSSCPKVSGFKKSELSDEGRWLYNLLRKKAGLTK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	57	299	4.2e-99	0.9915611814345991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.38e-76	55	306	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.75e-13	45	317	45	292	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA47670.1	1.35e-131	42	345	200	504
SIP56455.1	8.74e-126	45	339	85	377
CBK89462.1	1.63e-124	45	339	89	381
ACR74405.1	2.16e-124	45	339	85	377
CBK94241.1	2.86e-124	45	339	85	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZT_A	8.44e-98	23	335	13	320	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
6GJF_A	1.32e-93	45	341	11	302	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	2.37e-91	42	335	7	298	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	1.97e-90	45	335	10	299	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1H5V_A	4.53e-81	45	343	10	304	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22541	2.63e-102	32	335	105	403	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P10475	2.66e-93	42	335	37	325	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P15704	2.79e-92	34	332	37	328	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P07983	2.98e-92	42	347	37	337	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	2.36e-91	42	335	37	325	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004649	0.429140	0.565307	0.000402	0.000270	0.000216

TMHMM  Annotations     

start	end
13	30