CAZyme Information: MGYG000003695_00691

Basic Information

• Species: Ruminococcus_A sp003011855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp003011855
• CAZyme ID: MGYG000003695_00691
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000003695_3|CGC4	61407.06	4.6677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003695	3472119	Isolate	China	Asia

• Gene Location: Start: 153793; End: 155415 Strand: -

Full Sequence      

MQRQYRLGIPSFITVETEDSVWIGEKDAKRTEKGDVMVGYETTPETEEVWLTADQTKVKT
IKLRWNTPVNKKSRILGGSWERTYGDVDWKGVSGSRFMPWYFLAAAGETVTGYGVKVRPS
AMCFWQADTRGITLVMDVRCGGTGVQLSGRKLRAAQIVAMQTEGMGTFESAREFCKVMCT
DPILPDYPVYGSNNWYYAYGDSSEEEILQDTDYIVELTKGVDNPPYMVIDDCWQEHHRLN
EYNGGPWKKGNKKFPDMSALAKKLEEKGVRPGIWVRFLLNEEETIPKEWRLSHNDCLDPS
HPGVLSYIQEDVERICNWGYTLIKHDFTTFDIFGRWGVEMNPFPTEDGWQFYDTSKTSAE
IVTGLYQAIYETAKKHHTLIMGCNTIGHLGAGLMQLQRTGDDTSGITWERTKKMGVNTLA
FCLPQHGTFFDVDADCVGITGSIPWSLNRQWADVVAESGTSLFVSAKPGVLTAEENEELH
QIMLKASRQDHHKIPLDWEETDCPEVWGDEEEEVEYNWYEEAGPVAKGNDQLYHAYIPLS

Enzyme Prediction     

No EC number prediction in MGYG000003695_00691.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.45e-42	187	481	1	292	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	1.44e-12	188	327	1	124	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.39e-08	182	395	286	496	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14790	GH_D	1.48e-07	195	327	8	107	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.
cd06592	GH31_NET37	3.18e-04	187	275	2	78	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL19648.1	2.17e-272	1	537	19	558
QCU01578.1	1.45e-270	1	537	19	558
SNU96820.1	9.07e-256	10	539	11	543
BDA09953.1	2.66e-246	10	539	11	546
QIB59833.1	3.78e-246	10	540	11	547

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003695_00691.