CAZyme Information: MGYG000003695_01306

Basic Information

• Species: Ruminococcus_A sp003011855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp003011855
• CAZyme ID: MGYG000003695_01306
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000003695_6|CGC3	45281.22	4.7761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003695	3472119	Isolate	China	Asia

• Gene Location: Start: 172803; End: 174008 Strand: +

Full Sequence      

MNNIKIGYIGLGCRGKDLLENIVLAQKEQVTAVCDVYEDRAQEGAKVVEAAGQPTPFVST
DYKEIIANEEVNTIIIATAWESHVEIALAAMYAGKAVAMEVGGAYSLEDCYKLVDAYEKT
KTPFMFLENCCFGRRELMVLNMVEQGVLGEVVHCAGGYQHDLRDEIAYGKENRHYRLRNY
LSRNCENYPTHDLGPIAKILNINHGNRMLTLSSFASKSAGLHEFILQNKSDDEKLKQAHF
AQGDIITTMIRCANGETIQLTLDTTLPRYYSRNFTVRGTKGMYEEATDSVFIDRKEDRDH
DFDWRKECSGNADTYAETYDHPIWKKFLEEGVQGSHGGMDWLEFEQFFLCLREDSPMPVD
VYDAASWMAITALSEMSVARGGAVVNIPDFTNGRWVMELVK

Enzyme Prediction     

No EC number prediction in MGYG000003695_01306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	395	1.7e-147	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.83e-22	1	384	1	338	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.79e-11	4	125	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	1.29e-05	2	99	16	131	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK10206	PRK10206	6.75e-04	59	152	53	146	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	6.75e-186	1	396	1	396
QIB57148.1	3.54e-178	1	397	1	391
QMW80076.1	3.54e-178	1	397	1	391
QBE96673.1	3.54e-178	1	397	1	391
ALS29040.1	1.16e-173	2	396	3	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.11e-100	4	395	21	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	7.97e-67	1	395	40	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	1.90e-11	4	281	9	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3EC7_A	2.56e-09	4	156	24	174	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3EZY_A	7.40e-06	3	150	2	144	Crystalstructure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.70e-99	4	395	21	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	2.19e-97	4	396	53	460	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	3.67e-95	4	396	50	458	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
B2FLK4	7.16e-89	4	395	34	441	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	9.87e-85	4	395	43	432	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003695_01306.