CAZyme Information: MGYG000003696_00329

Basic Information

• Species: Collinsella sp003436275
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003436275
• CAZyme ID: MGYG000003696_00329
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39708.69	5.4465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003696	2284579	Isolate	China	Asia

• Gene Location: Start: 400935; End: 401996 Strand: -

Full Sequence      

MERILGVNLSGWFIPEPWVTPSLYAATGASNAAELQEAMGSAAYNERMRRHYETFVSEDD
FRRMAQIGLNAVRLPVPWYAFGSQGSDASYISVVDYIDRAIEWAAKYDIRVLLDLATVPG
GQGDSNDSPTTPEAVAEWHSSTNGRHVALDVLERLADRYGEAESLLGIELLDTPQMSVRK
SLFTMTDGIPAHYLRNFYRDAYELVRSYMPEDKIVVFSSSGHPSEWKHFMRGAKYKNVYM
DLHLYHYRDEYALDITSPRGLTTAISRNKRELKEAISTGFPVLVGEWSGAAIFANSSVTP
EGRNAYERVFIANQLASFAPAAGWFFQTWKTEKRIAAWDARAALGTLERGMIE

Enzyme Prediction     

No EC number prediction in MGYG000003696_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	311	5.5e-60	0.8741721854304636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.24e-27	1	333	15	366	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	9.70e-05	53	289	22	238	Cellulase (glycosyl hydrolase family 5).
pfam02449	Glyco_hydro_42	0.005	58	167	13	131	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68982.1	3.86e-261	1	353	1	353
ATP54675.1	3.04e-258	1	353	1	353
QIA34389.1	8.71e-258	1	353	1	353
AEB06471.1	1.07e-187	2	352	3	353
QWT17456.1	8.81e-174	3	353	28	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	8.08e-42	3	287	2	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.20e-41	3	287	2	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	1.58e-29	4	332	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	4.44e-29	4	332	14	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	5.71e-29	4	332	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	2.02e-43	2	339	29	382	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	2.02e-43	2	339	29	382	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
A2RAR6	1.91e-41	2	344	40	397	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q12626	5.41e-38	2	345	47	415	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
Q0CR35	1.05e-37	2	344	38	397	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003696_00329.