CAZyme Information: MGYG000003697_02548

Basic Information

• Species: Prevotella copri_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella copri_A
• CAZyme ID: MGYG000003697_02548
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000003697_37|CGC1	38809.8	9.2444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003697	3899884	Isolate	China	Asia

• Gene Location: Start: 12376; End: 13407 Strand: +

Full Sequence      

MKERRLCYISRTYYNQTSAGNKAKTDYEKVLHSMGAASIGLPCKIDNNKFLAFFYNLAST
LIACSRIQKGDVIVLQYPVKKYFSFICKMAHLKGAKTISLIHDLGSFRRKKLTVAQELKR
LSHTDYIIATNQAMKLWLEQQGLEKPIGALGFHDYLSPSVAADKKHQPNKVWNIVYAGSL
NLRKNAFILKMQELDYQFKFHLYGNMEDYDAVAKDKNIVWHGFMNADDFIKQVHGNFGLV
WDGDSLEECHGDFGSYLKYNTPHKASFYLRAGLPIIVWKESAIAPLVEERGVGFAINSLK
ELPGRLAGISEEEYAGMLAQTKQMAIAINNGENLKNAIQECSL

Enzyme Prediction     

No EC number prediction in MGYG000003697_02548.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	14	341	7.1e-94	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	3.37e-68	18	340	15	328	sugar transferase.
cd03794	GT4_WbuB-like	5.85e-13	50	298	79	346	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85168.1	8.56e-113	4	340	3	338
ALJ61055.1	1.37e-98	8	339	5	336
QUT93412.1	1.37e-98	8	339	5	336
QUT49973.1	4.91e-95	28	340	2	313
QQT78203.1	1.83e-85	6	340	2	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	1.22e-09	67	331	64	315	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	1.26e-09	67	331	72	323	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	3.37e-33	67	340	60	322	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	1.95e-16	70	331	65	318	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0H2UR93	3.12e-15	23	331	20	319	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B3XPQ7	1.73e-12	67	340	62	327	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	1.14e-10	67	340	67	332	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999939	0.000093	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003697_02548.