CAZyme Information: MGYG000003697_02747

Basic Information

• Species: Prevotella copri_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella copri_A
• CAZyme ID: MGYG000003697_02747
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000003697_43|CGC1	43239.63	8.1997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003697	3899884	Isolate	China	Asia

• Gene Location: Start: 17238; End: 18398 Strand: +

Full Sequence      

MLGKRILISAVCLLAMQGAMAQVDGVTGASVQTAGTSCSKDKKVCSKTPAEQLKIRLQKI
LNKGIMLGHQDDPVYGTTWKWDEGKSDVLLTTGDYPAVMGFDLGKIELDSKENLDGVPFD
RMRQEIIAQYKRGGIVTLSWHPWNPATGENAWDPKGDAVAAVLDGGAQQQKFDSWLKKVS
DFILSLKTNDGKLIPVIFRPWHEMNGGWFWWGANSCTPAQYNQLYANTYHRLTKAGCSNI
VWAWSPNLGSEKTVEAFLERFPGEQYVDMVGIDIYEFDNDDAAYQQNLSASLDVMMAAAK
KVGKIPALTETGCRGISQKKDWFTKTLWPVLQKYLVSYVLFWRNAWDKPQEEAYLPGVGD
GDIVNDFKAFKKEKKVLFVKDIKKVK

Enzyme Prediction     

No EC number prediction in MGYG000003697_02747.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	49	311	2.9e-61	0.8316831683168316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.13e-34	57	323	16	279	Glycosyl hydrolase family 26.
COG4124	ManB2	5.94e-19	134	282	112	263	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67784.1	1.69e-249	20	386	1	367
BCS86241.1	1.26e-139	44	384	17	351
AGH13968.1	4.17e-132	48	386	25	357
QUB85259.1	7.10e-126	48	383	14	348
QUB69107.1	2.15e-116	42	384	20	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.22e-98	57	381	19	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	6.60e-62	17	378	7	387	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	6.60e-62	17	378	7	387	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	1.18e-61	17	378	30	410	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	5.10e-61	17	378	7	387	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	6.44e-44	57	385	65	414	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	3.97e-33	85	370	84	386	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	2.11e-25	88	346	79	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	8.88e-24	57	306	190	427	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.93e-22	65	312	170	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999154	0.000144	0.000155	0.000142	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003697_02747.