CAZyme Information: MGYG000003701_00096

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_00096
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000003701_1|CGC3	83513.68	6.2164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 107246; End: 109453 Strand: +

Full Sequence      

MRKYLLLCVFAGFLVSAEAKTKMDWKAHWINTEQCQSASNTWLAYRKTVNLTDVPRTLTA
HIAADSKYWLWINGQMVVFEGGLKRGPSPYDTYYDSVEIAPYLTTGENTIAVLVWHFGKN
GFSHVNSGLAALLFEAVAPGIEIVSDKSWNCRVYDAYQNTEAPHPNYRLSESNIRFDARR
ALEGWNQPGYKNSFPGAEIASIVGKAPLGELVERPIPLFKDYGLREYPDVRQSANGDTLF
CRLPYNCQFTPYLKVEAADGATIHMQTDNYWGGGPENVRAEYITRNGIQEYESFGWMSGH
EMWYILPKGVKVLNVKYRETGYDTEFAGAFQCNDPFLNELWKRSARTLYITMRDNYMDCP
ERERAQWWGDEVNELGEAFYALSPSSHKLAVKGIYELMNWQRPDGSLFAPVPAGNWSKEL
PLQMLASVGWYGFYTQYYYSGDSTFVPVIYDRLHRYLHETWTVDKSGLPVERSGEWSWGD
WGEQIDMGVLTNCWYYLALKTEKEFALQLGKKEDAEEISRMMYSIEQCFNTKFWTGTAYR
SPGYRGEDDDRSQAMAVLSGLAPEEKYPALLKVLKKEYHASPYMEKYVLEALFRMNAPDV
ALQRMRDRYAGMLSYKEYTTLFEGWGVGAEGFGGGTINHAWSGGPLTLLSQKVCGIEPTS
PGFRTFRVKPQMGALTEASAIVPTHYGDIKVKLCKSGRNILVEIEVPEQVSAEVVSPKGK
IQKIGSGSYNLKCPF

Enzyme Prediction     

No EC number prediction in MGYG000003701_00096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	279	715	8.6e-86	0.8829365079365079
CBM67	27	193	1.7e-33	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.11e-25	325	653	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.96e-11	655	729	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.70e-09	55	217	3	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	0.0	1	732	1	730
QCY56550.1	0.0	25	729	31	735
BBK91319.1	0.0	16	731	4	719
QJE27360.1	0.0	25	731	31	737
QKH97686.1	0.0	25	731	32	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.42e-15	24	235	5	212	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999079	0.000173	0.000165	0.000149	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003701_00096.