CAZyme Information: MGYG000003701_01026

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_01026
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000003701_2|CGC1	40204.03	6.4883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 60132; End: 61217 Strand: -

Full Sequence      

MILLLFWNSISAQQVVPTIDISGQKERQVIIASGAEDIYQGHPTTVLMPDEKTIYCVWTF
GHGGVCGPMAKSSDGGKSWTQIVTPKDWSTMKNCPSLYLMADHTGKQRLMIYASEPLMAQ
VCSEDYGETWTSVKSLGIPCVMAFTSMVRLKNGNYLAMYNCRPEGITGPPQNEVWQAISE
DGGLSWGKTKLIIPNTMDNIPCEPCVFDSPDRKELACLIRDNKRDGHSLLIFSLDEGETW
SEVKEAPWGLTGDRHVVKYAPDGRMVVAFRDMAPFSPTRGHFVIWVGNYNDLKKQSGGQY
KVKLLHSYAGSDCGYPGLEVLPDGTFVATTYIKYEEGNKKHSVVSVRFKLEETDKILGYA
K

Enzyme Prediction     

No EC number prediction in MGYG000003701_01026.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.71e-25	69	348	49	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.66e-08	123	326	87	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	4.92e-07	72	192	143	257	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	2.18e-05	72	271	6	184	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU73633.1	1.33e-107	16	356	204	544
QDV35524.1	2.67e-89	16	354	39	379
ALG49063.1	2.70e-53	16	357	199	567
ABG82852.1	5.25e-53	16	357	199	567
SQG39657.1	5.25e-53	16	357	199	567

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.274992	0.723924	0.000275	0.000312	0.000234	0.000247

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003701_01026.