CAZyme Information: MGYG000003701_01529

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_01529
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		86325.13	5.8533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 734004; End: 736343 Strand: -

Full Sequence      

MKKIVLEVAMDVLTLGLQECKEIKKFVCLIAVFLLCGQLSAREYHVSVKGRDTNAGSLSA
PFQTIQAAADKAMPGDVVIVHEGVYRERVAPPKGGTSNKMRIIYQVAPGEQVTITGSEPV
KGWSKMQDDVWKLTLPNSFFGEGNPFDELIYGSWYRGKGRPNHTGNVFLNGKRIRETFSL
ESLLHSDENRQGWYAEADGNGGPVLMNFEWIQPAGGQRMTSMQASVDGGDQAVCIAIVDR
WPFGYLKDGSVMYFEGVDFASGTDTLFYQAATLAKGGIVEMHLGTPDGELLGSSMVTNTG
DWEQFAVFPMKMSRKLAGKQDICLVLKAPDLKVDGKTTLWVKFPNGIDPNKESVEITVRP
QVFYPDKTGIDFITVRGFTLENAATNWAPPSAEQPGLIGPRWAKGWIIENNTIRNSRCSG
ISLGRPTYGHAHHYQKELPVIYPEPDAGQSKEQLADYFADASWTKEEAGFHIVRNNHIYE
CGQTGIVGCSGGAFSLIEGNEIHDVCLDETFEGDEMAGIKLHFANDAVIKDNHIYKCIRG
IWIDWGATGMQIVGNLLHNNDKLEDLFIEVCHGPTLVANNICLSGYSICLSQGIACIHNI
ATGKIFAGIDRCAGGRKSFIYEPHGTVSVGNIKNNGGDLQWYNNLLSDKASLNHWDEPQL
PLRFVGNVFSNGAEPSPDDKSYLLLKEFVPDVKLEQKEDGWYLSMNVSKEWKKAPCKLMT
TKNIENAITPDLPFINPDDSKLKLDFDYWGNKRKGARPFPGAIEMKGEGRQEWKVWPKE

Enzyme Prediction     

No EC number prediction in MGYG000003701_01529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	471	560	8.4e-28	0.978021978021978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	8.84e-17	244	343	27	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
smart00606	CBD_IV	7.17e-11	244	343	34	129	Cellulose Binding Domain Type IV.
pfam13229	Beta_helix	1.41e-09	472	562	58	139	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam03422	CBM_6	2.54e-09	244	328	26	110	Carbohydrate binding module (family 6).
pfam13229	Beta_helix	2.19e-08	473	622	13	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW10547.1	0.0	32	778	9	761
AOW10546.1	0.0	32	778	9	760
AOW08578.1	0.0	41	778	18	757
ARN56185.1	1.04e-192	21	776	6	753
ARN56258.1	6.20e-191	29	775	13	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	4.95e-129	43	776	2	638	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
1W9S_A	5.83e-07	208	327	12	123	ChainA, Bh0236 Protein [Halalkalibacterium halodurans],1W9S_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9W_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans]
1O8P_A	8.06e-06	203	329	8	138	Unboundstructure of CsCBM6-3 from Clostridium stercorarium [Thermoclostridium stercorarium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.255686	0.489231	0.253362	0.000464	0.000426	0.000826

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003701_01529.