CAZyme Information: MGYG000003702_00341

Basic Information

• Species: Eisenbergiella sp900066775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900066775
• CAZyme ID: MGYG000003702_00341
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		29434.6	7.084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003702	3523328	Isolate	China	Asia

• Gene Location: Start: 381883; End: 382632 Strand: +

Full Sequence      

MSIPKKIHYCWFGRNPLPESAKKCIESWKKYCPEYEIIEWNEDNFDLTDNRYAREAYEQK
KWAFVSDYARLKIVYEQGGIYMDVDVELIKPLDELTELDGYMGFEKEIDGQMWIATGLGF
GARAGHPIVGALLKDYEDIPFIKEDGRLDTESCPGRNTRTLRTFGLRLDNTKQEIDGIVF
LPTQYLAPVSYFHRKKEITEHTVSIHHYDGSWLNEKEQKSLQLRRLLGNRLYHRLQCLWY
KINPRKKQP

Enzyme Prediction     

No EC number prediction in MGYG000003702_00341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	96	4.4e-25	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.98e-22	3	144	82	219	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.62e-19	18	95	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	4.81e-11	3	134	46	186	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.005	42	85	140	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCW96683.1	5.03e-82	3	238	2	233
AZQ18018.1	5.03e-82	3	238	2	233
QSP99106.1	5.03e-82	3	238	2	233
QQJ91624.1	5.03e-82	3	238	2	233
ANB94239.1	5.03e-82	3	238	2	233

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.91e-06	2	102	56	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003702_00341.