CAZyme Information: MGYG000003702_01034

Basic Information

• Species: Eisenbergiella sp900066775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900066775
• CAZyme ID: MGYG000003702_01034
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000003702_5|CGC1	75149.14	6.5859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003702	3523328	Isolate	China	Asia

• Gene Location: Start: 33349; End: 35307 Strand: -

Full Sequence      

MEEKKDYQDAYEKEHYKAVYLANRVAELEDQVDDLQFKLNRIKNNPIWKASGPARKCMHF
VIRQKDRLKNCGSLSGVIAKVRYKSWEKKAMTHYGTRSFPSAEERQKQEEAVFERMPKIS
ILVPLWNTPESFLTEMIGSVQWQTYKNWELCLADGSDDAHAYVGEYCKRLAAQDSRIVYQ
KLAKNEGISGNTNECYKLATGEFIGLFDHDDILHPCALYEYVKAINEKDADFIYCDEATF
KSPDINKMITMHFKPDYAIDNLRANNYICHFSVFSRELLDGTELFRTKFDGSQDHDMILR
LTDNAKHIVHVPKLLYYWRSHAGSVAGNIEAKPYVVEAARGAVADHLRRHGFKNFTITST
RAFETIFKISYEIIGEPKISIIIPNKDHVEDLRRCISSIVEKSTWENYEIIVVENNSETK
EIFSYYDELQNNPQIRVVTFEGKFNYSKINNFGVSLATGDYVLLLNNDTQVITINWMEEL
LMYAQRPDVGAVGGKLYYGDKTIQHAGVVIGLGAHRTAGHVHYRQKRENLGYMGRLCYAQ
DMTAVTGACLLVKKSLYEQVGGLDESFEISLNDVDFCLKLRKAGYLNVFTPFAELYHFES
ISRGLDDQGEKAKRYNEESERFRNKWKAELEAGDPYFNPNFSLDKSDFSLRV

Enzyme Prediction     

No EC number prediction in MGYG000003702_01034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	380	559	3.5e-23	0.9823529411764705
GT2	120	279	2.4e-21	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.12e-86	117	319	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	8.90e-42	381	599	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.12e-30	375	604	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.81e-21	380	533	1	152	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	6.96e-19	120	324	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33299.1	0.0	6	652	5	673
AOZ95572.1	0.0	6	652	5	675
QNM02106.1	0.0	6	651	5	678
QUO22278.1	2.71e-300	23	651	5	629
CAB1243278.1	5.62e-242	13	651	386	1033

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.60e-124	117	650	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.16e-80	109	651	309	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	7.43e-12	117	304	8	197	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	2.19e-09	119	325	5	221	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P9WMY2	5.49e-09	545	606	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003702_01034.