CAZyme Information: MGYG000003702_01921

Basic Information

• Species: Eisenbergiella sp900066775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900066775
• CAZyme ID: MGYG000003702_01921
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	MGYG000003702_11|CGC3	100547.16	4.7751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003702	3523328	Isolate	China	Asia

• Gene Location: Start: 107421; End: 110021 Strand: +

Full Sequence      

MLVWRLPASDQITECTKGKGTAMKQQFLHENWEMRQIGNDEFLPAAVPGSVYGDLLSNGK
MENPFWKDNENDACELMEEDYEYVSHFDCEDGLLDSDRVVLRFDGIDTVGDVYLNEIHLG
SPLSMHRVWEYDVKEILHDKDNELKVILHSPNKWIREAFKKCRTLGNDDTFEGFVHLRKA
HYMFGWDWGAHLPDAGIFRPVSLLGINTARIDSVYIKQTHERTGETEPGTVRPITKSVTL
TFDVEQEVVGNAERGPKLKNITGGHTCKKCGKAYTYTVEITAPDGSKTLYENSPVEVKID
EPKLWWPNGYGEQNLYEVKVTLFSDGVALDEWTRRIGLRTMTMHIEKDEWGECFAHQVNG
VDVFAMGADYIPEDNLLGRVNPETTRKLLEKAKFANYNAIRVWGGGYYPSDWFYDICDEL
GLMVWQDFMFACAVYELTPEFEANIRQEFIENVKRLRHHASLGLWCGNNEMEQFVFERNS
WLTKPSEVKDYFLMFERIIPEIVHEYDPQTFYWPASPSSGGCLDEPNDPNRGDVHYWKVW
HGNRPFTEYRKYFFRYLSEFGFQAFPSVKTIEQFTDNEEDMNPFSYIMEKHQRQYSANGK
IMGYMQQTYKYPNSFPTFVYASQLLQADGIRYGVEHFRRNRGRCMGAVYWQLNDCWPVIS
WSSVDYCGRLKALHYYAKRFFAPLMISCEEQGMMSSEANMNREHFVFEKSIRLNVANETM
QDQNVTVRWALRDPGAAVLESGEQELTVPALTSTWLDKVEFPDADIFSHYVSYELICDGK
VVSEGTVNFSYPKYFRYEDPELTCRVEGDEIVVSAKAYAKSVEILNENEDLVLEDNYFDL
NANEKRVKVISGSTENLRLRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000003702_01921.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	755	3.3e-100	0.6941489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.96e-94	23	687	10	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.38e-15	711	794	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	5.18e-12	209	339	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.14e-09	95	470	124	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	6.76e-09	799	864	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW80334.1	0.0	20	866	20	841
QIB56890.1	0.0	20	866	20	841
QBE96379.1	0.0	20	866	20	841
QJU13790.1	0.0	23	866	1	823
QQQ93614.1	0.0	23	866	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.47e-143	28	866	8	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.53e-143	28	866	8	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.79e-142	28	866	6	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.84e-142	28	866	8	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.90e-140	28	692	11	662	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QYN2	2.00e-117	22	799	3	770	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q0CCA0	3.99e-116	25	852	6	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	1.70e-112	22	852	3	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	1.32e-111	25	852	5	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	5.03e-111	25	852	5	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000024	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003702_01921.