CAZyme Information: MGYG000003702_02857

Basic Information

• Species: Eisenbergiella sp900066775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900066775
• CAZyme ID: MGYG000003702_02857
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		40124.35	6.8781

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003702	3523328	Isolate	China	Asia

• Gene Location: Start: 33979; End: 35025 Strand: +

Full Sequence      

MKIINKINPRISAFKFKDEVRGFLINSLLKNEKILAFYPNCSLDEKGHSAVGWMEYKRSE
DYGETWSQPYIFQPSLKLLHSEMKYSAMCEKAIVNEKGDIIVYQLICDISNDPQWQPYMV
PSYSISRDKGSTWSNLRQIGTRRGRIYDAMYQEGTIFLLLFVNDATVDWTGQTTDHYYSL
VVSEDGGENYYERSRIPIPSLHHGYGSMMFLEDGRLIVYNYNLDDEYNLSYVLSEDKGMS
WGQAGTTFVAKKIRNPQVVGFEHLYFLHGRSGNNGEQAGNFVLYCSEDGIHWDEGRYLKV
RTEGLGAYSNNLVIGKGTSHEKLLIQASHAYKDNQTNVLHWQIIKRKV

Enzyme Prediction     

No EC number prediction in MGYG000003702_02857.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	18	317	5.5e-16	0.8859649122807017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.37e-14	25	318	16	317	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.008	33	228	89	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXD25708.1	2.20e-110	33	343	71	390
QXD29777.1	2.20e-110	33	343	71	390
QDT91551.1	1.01e-102	22	341	64	387

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003702_02857.