CAZyme Information: MGYG000003705_00199

Basic Information

• Species: Garciella sp900555725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Eubacteriales; Garciellaceae; Garciella; Garciella sp900555725
• CAZyme ID: MGYG000003705_00199
• CAZy Family: CBM50
• CAZyme Description: putative peptidoglycan endopeptidase LytE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
176	MGYG000003705_6|CGC1	19461.39	6.4228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003705	2521949	MAG	Russia	Europe

• Gene Location: Start: 12278; End: 12808 Strand: +

Full Sequence      

MYYNTPGCSMRTFPYTIMPGDTLYSIAIRYNTTVNDILMANPRINPYCLRIGQIICIPMP
PVPQPCPAGTFPYAIQAGDTFYSIARRYHVSVEELLAANPGVDPNNLRIGQKICIPESTP
PPSDCPTGTFAYTIRSGDTFYLLAQRFHTTVEAIQAANPDADPNNLIIGEKLCIPR

Enzyme Prediction     

No EC number prediction in MGYG000003705_00199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	73	116	3.3e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00257	LysM	1.92e-16	73	115	2	44	Lysin motif.
cd00118	LysM	5.00e-16	73	115	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	7.35e-15	15	57	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	8.38e-14	73	116	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	2.20e-13	132	174	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABW19482.1	4.12e-70	8	175	419	588
QUH21634.1	1.03e-69	7	175	11	182
ACV62122.1	7.19e-64	3	176	8	179
ADG81515.1	6.17e-62	8	176	10	173
QAT63505.1	8.69e-60	6	175	102	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	5.64e-21	9	176	38	218	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
5K2L_A	9.17e-09	15	58	5	48	Crystalstructure of LysM domain from Volvox carteri chitinase [Volvox carteri f. nagariensis],5YZK_A Solution structure of LysM domain from a chitinase derived from Volvox carteri [Volvox carteri f. nagariensis]
5YZ6_A	1.33e-07	73	116	5	48	Solutionstructure of LysM domain from a chitinase derived from Volvox carteri [Volvox carteri f. nagariensis]
5BUM_A	3.69e-07	73	115	6	48	CrystalStructure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]
4PXV_A	9.79e-07	73	115	5	47	CrystalStructure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	9.16e-11	13	138	2	112	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P07540	4.23e-09	73	172	163	255	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	4.23e-09	73	172	163	255	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
Q9P403	3.92e-07	17	116	112	228	Intracellular hyphae protein 1 OS=Colletotrichum lindemuthianum OX=290576 GN=CIH1 PE=1 SV=1
Q7A123	1.13e-06	11	67	173	229	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MW2) OX=196620 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003705_00199.